Home » Glypican 4 » Glypican 4 Proteins » Glypican 4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Glypican 4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Glypican 4 Protein (NBP1-87697PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Glypican 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPC4.

Source: E. coli

Amino Acid Sequence: SKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87697.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glypican 4 Recombinant Protein Antigen

  • Glypican 4
  • glypican proteoglycan 4
  • glypican-4
  • GPC4
  • K-glypican
  • K-glypicandJ900E8.1 (glypican 4)

Background

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with avariable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family(GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. Theseproteins may play a role in the control of cell division and growth regulation. The GPC4 gene is adjacent to the3' end of GPC3 and may also play a role in Simpson-Golabi-Behmel syndrome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glypican 3
Antibody [Unconjugate
AF2119
Immunocytochemistry Glypican 3 Antibody [Unconjugated]
Immunohistochemistry Glypican 3 Antibody [Unconjugated]
Western Blot Glypican 3 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, IHC, WB
Glypican 1 Antibody
NBP1-33197
Western Blot Glypican 1 Antibody
Western Blot Glypican 1 Antibody
Western Blot Glypican 1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Glypican 6
Antibody [Unconjugate
AF1053
Western Blot Glypican 6 Antibody [Unconjugated]
Western Blot Glypican 6 Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: IHC, WB
Syndecan-2/CD362
Antibody [Unconjugate ...
AF6585
Western Blot Syndecan-2/CD362 Antibody [Unconjugated]
Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]
Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Glypican 5
Antibody (297716) [Un ...
MAB2607
Glypican 5 Antibody (297716) [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(533 Publications)
Species: Hu
Applications: BA
FGF-13 Antibody
NBP2-16471
Immunohistochemistry-Paraffin FGF-13 Antibody
Western Blot FGF-13 Antibody
Immunohistochemistry-Paraffin FGF-13 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Endorepellin/Perlecan/ ...
AF2364
Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
BPI [Unconjugated]
7468-BP
BPI [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
Ext2 Antibody
NBP1-58297
Western Blot Ext2 Antibody
Immunohistochemistry Ext2 Antibody
Western Blot Ext2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Syndecan-1/CD138
Antibody
AF2780
Immunohistochemistry Syndecan-1/CD138 Antibody
Immunohistochemistry Syndecan-1/CD138 Antibody
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Musashi-1 Antibody
[Unconjugated]
AF2628
Western Blot Musashi-1 Antibody [Unconjugated]
Immunohistochemistry Musashi-1 Antibody [Unconjugated]
Immunocytochemistry Musashi-1 Antibody [Unconjugated]
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
SLC35B2 Antibody
NBP1-80641
Immunohistochemistry-Paraffin SLC35B2 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
PGPEP-1 Antibody
AF6278
Western Blot PGPEP-1 Antibody
Species: Hu, Mu
Applications: WB

Publications for Glypican 4 Protein (NBP1-87697PEP) (0)

There are no publications for Glypican 4 Protein (NBP1-87697PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glypican 4 Protein (NBP1-87697PEP) (0)

There are no reviews for Glypican 4 Protein (NBP1-87697PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glypican 4 Protein (NBP1-87697PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glypican 4 Products

Research Areas for Glypican 4 Protein (NBP1-87697PEP)

Find related products by research area.

Blogs on Glypican 4

There are no specific blogs for Glypican 4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glypican 4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GPC4