Novus Biologicals products are now on bio-techne.com

GLI-1 Recombinant Protein Antigen

Images

 
There are currently no images for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

GLI-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLI-1.

Source: E. coli

Amino Acid Sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56230.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLI-1 Recombinant Protein Antigen

  • GLI family zinc finger 1
  • GLI1
  • GLI-1
  • glioma-associated oncogene family zinc finger 1
  • glioma-associated oncogene homolog 1 (zinc finger protein)
  • Glioma-associated oncogene
  • GLIzinc finger protein GLI1
  • Oncogene GLI

Background

Gli1 was produced against a peptide corresponding to the carboxy-terminal region of the mouse Gli-1 protein. This region is not conserved among other gli family members, namely Gli-2 and Gli-3. Gli was termed by Kinzler et al. (1987) as 'glioma-associated oncogene' amplified in malignant gliomas. Analysis of the cloned gene demonstrates that the gene contains 5 repeats of zinc-finger sequences, which places gli in the family of Kruppel (Kr) zinc finger proteins. Northern analysis reveals that GLI is expressed in embryonal carcinoma cells but not in most adult tissue. GLI has been localized to 12q13-q14.3 by Southern blot analysis. On mouse the gene is located on chromosome 10. In mice, 3 zinc finger transcription factors, Gli-1, Gl-i2 and Gli-3, have been implicated in the transduction of Sonic hedgehog (Shh) signal. In papillary epithelium, shh, gli1 and ptc all follow similar expression patterns. Gli1 expression is central and probably sufficient for tumor development in humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB41051
Species: Hu, Mu
Applications: IHC, WB
AF3635
Species: Mu
Applications: IHC, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
AF1705
Species: Mu
Applications: IHC, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-87384
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: IHC, WB
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Publications for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP) (0)

There are no publications for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP) (0)

There are no reviews for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLI-1 Products

Research Areas for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP)

Find related products by research area.

Blogs on GLI-1

There are no specific blogs for GLI-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLI-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI1