Home » Gephyrin/GPHN » Gephyrin/GPHN Proteins » Gephyrin/GPHN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Gephyrin/GPHN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Gephyrin/GPHN Protein (NBP1-87876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Gephyrin/GPHN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPHN.

Source: E. coli

Amino Acid Sequence: SRCSSKENILRASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCGADAVVQVEDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPHN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gephyrin/GPHN Recombinant Protein Antigen

  • GEPH
  • Gephyrin
  • GPH
  • GPHN
  • GPHRYN
  • KIAA1385GPHGEPH

Background

The Gephyrin (GPHN) gene encodes a neuronal assembly protein that exists in isoform 1 (736 amino acids long, 79 kDA) or isoform 2 (769 amino acids in length, approximately 83 kDA). This protein anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton through high affinity binding to a receptor subunit domain and tublin dimers. The protein coded by GPHN is also necessary for molybdenum biosynthesis. The GPHN gene has been investigated in relation to many diseases such as leukemia, cervicitis, tuberculosis, alzheimer's disease, anorexia nervosa, huntington's disease, retinitis, and herpes zoster. The GPHN gene interacts with genes DYNLL1, PFN1, PRPF4, ENAH, and SLX4 to participate in pathways that regulate metabolism of vitamins and cofactors as well as molybdenum cofactor biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


Collybistin/ARHGEF9 An ...
MAB7848
Western Blot Collybistin/ARHGEF9 Antibody (809309) [Unconjugated]
Immunohistochemistry Collybistin/ARHGEF9 Antibody (809309) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
VIAAT/SLC32A1/VGAT
Antibody
NBP2-20857
Immunohistochemistry-Paraffin VIAAT/SLC32A1/VGAT Antibody
Immunocytochemistry/ Immunofluorescence VIAAT/SLC32A1/VGAT Antibody
Western Blot VIAAT/SLC32A1/VGAT Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
GARS Antibody
NBP3-35329
Western Blot GARS Antibody
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Neuroligin 2/NLGN2
Antibody - BSA Free
NBP2-41299
Immunocytochemistry/ Immunofluorescence Neuroligin 2/NLGN2 Antibody - BSA Free
Immunohistochemistry Neuroligin 2/NLGN2 Antibody - BSA Free
Western Blot Neuroligin 2/NLGN2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GlyT2/SLC6A5
Antibody
NBP2-86653
Immunohistochemistry-Paraffin GlyT2/SLC6A5 Antibody
Western Blot GlyT2/SLC6A5 Antibody
Western Blot GlyT2/SLC6A5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GAD2/GAD65
Antibody [Unconjugate
AF2247
Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
Synaptophysin
Antibody
NB300-653
Immunohistochemistry-Frozen Synaptophysin Antibody
Western Blot Synaptophysin Antibody
Immunohistochemistry-Paraffin Synaptophysin Antibody
(2 Reviews)
(11 Publications)
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GABARAP Antibody -
BSA Free
NBP1-71771
Immunocytochemistry/ Immunofluorescence GABARAP Antibody - BSA Free
Immunohistochemistry GABARAP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GABARAP Antibody - BSA Free
(3 Publications)
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
GLRB Antibody
(3B8A8) - BSA Free
NBP2-61774
ELISA GLRB Antibody (3B8A8) - BSA Free
ELISA GLRB Antibody (3B8A8) - BSA Free
Immunocytochemistry/ Immunofluorescence GLRB Antibody (3B8A8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
MOCS2 Antibody
NBP1-81045
Western Blot MOCS2 Antibody
Immunocytochemistry/ Immunofluorescence MOCS2 Antibody
Immunohistochemistry-Paraffin MOCS2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Glycine Receptor
Alpha 1 Antibody - Az ...
NB300-113
Western Blot Glycine Receptor Alpha 1 Antibody - Azide and BSA Free
Western Blot Glycine Receptor Alpha 1 Antibody - Azide and BSA Free
Western Blot Glycine Receptor Alpha 1 Antibody - Azide and BSA Free
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IP, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
(1 Review)
(31 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MOCS1 Antibody
NBP1-92130
Immunohistochemistry-Paraffin MOCS1 Antibody
Immunohistochemistry-Paraffin MOCS1 Antibody
Immunocytochemistry/ Immunofluorescence MOCS1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
SUOX Antibody
NBP1-32423
Immunocytochemistry/ Immunofluorescence SUOX Antibody
Western Blot SUOX Antibody
Immunohistochemistry-Paraffin SUOX Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB

Publications for Gephyrin/GPHN Protein (NBP1-87876PEP) (0)

There are no publications for Gephyrin/GPHN Protein (NBP1-87876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gephyrin/GPHN Protein (NBP1-87876PEP) (0)

There are no reviews for Gephyrin/GPHN Protein (NBP1-87876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gephyrin/GPHN Protein (NBP1-87876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gephyrin/GPHN Products

Research Areas for Gephyrin/GPHN Protein (NBP1-87876PEP)

Find related products by research area.

Blogs on Gephyrin/GPHN

There are no specific blogs for Gephyrin/GPHN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
PSD-95 Antibody (6G6-1C9) - BSA Free
NB300-556
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of different tissue lysates and recombinant protein solutions using chicken pAb to calbindin, NBP2-50028, dilution 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] pig hippocampus, [4] cow cerebellum, [5] protein standard (red). Next lanes are full length recombinant human proteins, [6] Parvalbumin, [7] Calretinin, [8] Calbindin. Bands at 25kDa in tissue lysates and ~30 kDa in protein solutions correspond to calbindin, the recombinant form being slightly larger due to the presence of a His tag and other vector derived sequence. NBP2-50028 antibody specifically recognizes calbindin protein and does not react with the closely related proteins parvalbumin and calretinin.
Calbindin D-28K Antibody
NBP2-50028

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gephyrin/GPHN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GPHN