Home » Gas1 » Gas1 Proteins » Gas1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Gas1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Gas1 Recombinant Protein Antigen (NBP2-49497PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Gas1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Gas1.

Source: E. coli

Amino Acid Sequence: TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GAS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49497.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gas1 Recombinant Protein Antigen

  • Gas1
  • GAS-1
  • growth arrest-specific 1
  • Growth arrest-specific gene-1
  • growth arrest-specific protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(68 Publications)
Species: Mu
Applications: BA
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Clusterin/APOJ
Antibody [Unconjugate
AF2747
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Western Blot Clusterin/APOJ Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Patched 1/PTCH
Antibody (413220) [Un ...
MAB41051
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
(10 Publications)
Species: Hu, Mu
Applications: IHC, WB
GAS2 Antibody
(4E11)
H00002620-M01
Western Blot GAS2 Antibody (4E11)
Immunocytochemistry/ Immunofluorescence GAS2 Antibody (4E11)
Sandwich ELISA GAS2 Antibody (4E11)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Gastrin Antibody
NBP3-12223
Immunohistochemistry-Paraffin Gastrin Antibody
Unknown Gastrin Antibody
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Immunocytochemistry/ Immunofluorescence N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
PA1 Antibody
NBP1-06542
Immunohistochemistry PA1 Antibody
Immunohistochemistry-Paraffin PA1 Antibody
Western Blot PA1 Antibody
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
CDO Antibody
[Unconjugated]
AF2429
Western Blot CDO Antibody [Unconjugated]
Knockout Validated CDO Antibody [Unconjugated]
Knockdown Validated CDO Antibody [Unconjugated]
(12 Publications)
Species: Mu
Applications: IHC, WB
Recombinant Human
Fucosyltransferase 1/ ...
H00002523-P01
Other Recombinant Human Fucosyltransferase 1/FUT1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
HFE Antibody (1G12)
H00003077-M01
Western Blot HFE Antibody (1G12)
Immunocytochemistry/ Immunofluorescence HFE Antibody (1G12)
Western Blot HFE Antibody (1G12)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
GLI-1 Antibody -
BSA Free
NB600-600
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
Knockdown Validated GLI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
(1 Review)
(55 Publications)
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
CD47 Antibody
[Unconjugated]
AF4670
Western Blot CD47 Antibody [Unconjugated]
Neutralization CD47 Antibody [Unconjugated]
Immunohistochemistry CD47 Antibody [Unconjugated]
(4 Reviews)
(14 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Gas6 [Unconjugated]
885-GSB
Bioactivity Gas6 [Unconjugated]
(1 Review)
(38 Publications)
Species: Hu
Applications: BA
PMP22 Antibody
(Hu1) - Azide and BSA ...
NBP2-80913
Immunohistochemistry PMP22 Antibody (Hu1) - Azide and BSA Free
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Gas1 Recombinant
Protein Antigen
NBP2-49497PEP
Gas1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Gas1 Recombinant Protein Antigen (NBP2-49497PEP) (0)

There are no publications for Gas1 Recombinant Protein Antigen (NBP2-49497PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gas1 Recombinant Protein Antigen (NBP2-49497PEP) (0)

There are no reviews for Gas1 Recombinant Protein Antigen (NBP2-49497PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gas1 Recombinant Protein Antigen (NBP2-49497PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gas1 Products

Blogs on Gas1

There are no specific blogs for Gas1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - Staining in canine hair follicle. Image from a verified customer review.
GLI-1 Antibody - BSA Free
NB600-600

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gas1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GAS1