![Western Blot: Gankyrin Antibody [NBP1-82443] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/Gankyrin-Antibody-Western-Blot-NBP1-82443-img0009.jpg "Western Blot: Gankyrin Antibody [NBP1-82443] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMD10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry IL-17D Antibody (246018) [Unconjugated]](https://images.novusbio.com/images2/IL-17D_MAB15041_Immunohistochemistry_6949.jpg)
![Intracellular Staining by Flow Cytometry IL-17D Antibody (246018) [Unconjugated]](https://images.novusbio.com/images2/IL-17D_MAB15041_Flow_Cytometry_8338.jpg)
| Publication using NBP1-82443 | Applications | Species |
|---|---|---|
| Camacho-Moll ME, Macdonald J, Looijenga LHJ et al. The oncogene Gankyrin is expressed in testicular cancer and contributes to cisplatin sensitivity in embryonal carcinoma cells BMC Cancer 2019-11-19 [PMID: 31744479] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Gankyrin Antibody (NBP1-82443)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSMD10 |
![Immunocytochemistry/Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Gankyrin expression in invasive TGCC. a-d Gankyrin (red), POU5F1 (green; GCNIS cells), and MAGE-A4 (blue; spermatogonia) expression in GCNIS containing tubules from patients with invasive TGCC, yellow arrows - GCNIS cells, orange arrows - Sertoli cells. e and f Gankyrin (red), POU5F1 (green; seminoma cells), and MAGE-A4 (blue) expression in seminoma cells (e) and a mixed TGCC (e), inset on D - no primary antibody control. Scalebars - 50 um. Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-019-6340-7), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Gankyrin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82443-img0012.jpg "Immunocytochemistry/Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Gankyrin expression in invasive TGCC. a-d Gankyrin (red), POU5F1 (green; GCNIS cells), and MAGE-A4 (blue; spermatogonia) expression in GCNIS containing tubules from patients with invasive TGCC, yellow arrows - GCNIS cells, orange arrows - Sertoli cells. e and f Gankyrin (red), POU5F1 (green; seminoma cells), and MAGE-A4 (blue) expression in seminoma cells (e) and a mixed TGCC (e), inset on D - no primary antibody control. Scalebars - 50 um. Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-019-6340-7), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferous ducts.](http://images.novusbio.com/fullsize/Gankyrin-Antibody-Immunohistochemistry-Paraffin-NBP1-82443-img0010.jpg "Immunohistochemistry-Paraffin: Gankyrin Antibody [NBP1-82443] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferous ducts.")
![Western Blot: Gankyrin Antibody [NBP1-82443] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PSMD10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Gankyrin-Antibody-Western-Blot-NBP1-82443-img0011.jpg "Western Blot: Gankyrin Antibody [NBP1-82443] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PSMD10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://images.novusbio.com/fullsize/Gankyrin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82443-img0003.jpg "Immunocytochemistry/Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Staining of human cell line A-431 shows positivity in cytoplasm.")
![Knockdown Validated: Gankyrin Antibody [NBP1-82443] - Effects of Gankyrin knock-down on Gankyrin and POU5F1 expression. Representative Western blot for Gankyrin and POU5F1 expression in (V) vehicle and Gankyrin siRNA (T) transfected NTera2 cells. Tubulin was used as a loading control. Data analysed by paired t-test +/- SEM, ***p < 0.001, **p < 0.01. Each data point represents the mean of an individualexperiment, each with 3 replicates. Paired samples from an individual experiment are represented by the same colour. Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-019-6340-7), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Gankyrin-Antibody-Knockdown-Validated-NBP1-82443-img0013.jpg "Knockdown Validated: Gankyrin Antibody [NBP1-82443] - Effects of Gankyrin knock-down on Gankyrin and POU5F1 expression. Representative Western blot for Gankyrin and POU5F1 expression in (V) vehicle and Gankyrin siRNA (T) transfected NTera2 cells. Tubulin was used as a loading control. Data analysed by paired t-test +/- SEM, ***p < 0.001, **p < 0.01. Each data point represents the mean of an individualexperiment, each with 3 replicates. Paired samples from an individual experiment are represented by the same colour. Image collected and cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/s12885-019-6340-7), licensed under a CC-BY license.")
![Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82443_rabbit-polyclonal-gankyrin-antibody-310202415363742.jpg "Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Gankyrin expression pre-invasive germ cells. a) 1 year old - maturation delay; b) 2 year old – maturation delay; c) 7 year old pre-invasive TGCC; d)17 year old pre-invasive TGCC; & e) 23 year old pre-invasive TGCC. Yellow arrows – GCNIS cells, orange arrows – Sertoli cells. This experiment was performed along with human fetal testis samples, no primary antibody control is the same as on Fig. 1, Scalebars - 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82443_rabbit-polyclonal-gankyrin-antibody-310202415371969.jpg "Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Gankyrin expression pre-invasive germ cells. a) 1 year old - maturation delay; b) 2 year old – maturation delay; c) 7 year old pre-invasive TGCC; d)17 year old pre-invasive TGCC; & e) 23 year old pre-invasive TGCC. Yellow arrows – GCNIS cells, orange arrows – Sertoli cells. This experiment was performed along with human fetal testis samples, no primary antibody control is the same as on Fig. 1, Scalebars - 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82443_rabbit-polyclonal-gankyrin-antibody-310202415371928.jpg "Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82443_rabbit-polyclonal-gankyrin-antibody-31020241517135.jpg "Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Gankyrin Antibody [NBP1-82443] - Effects of Gankyrin knock-down on Gankyrin & POU5F1 expression. Relative Gankyrin mRNA(a) & protein (b) expression in NTera2 cells after Gankyrin knock-down. Relative POU5F1 mRNA (c) & protein (d) expression in NTera2 cells after Gankyrin knock-down. e Representative Western blot for Gankyrin & POU5F1 expression in (V) vehicle & Gankyrin siRNA (T) transfected NTera2 cells. Tubulin was used as a loading control. Data analysed by paired t-test ± SEM, ***p < 0.001, **p < 0.01. Each data point represents the mean of an individualexperiment, each with 3 replicates. Paired samples from an individual experiment are represented by the same colour. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82443_rabbit-polyclonal-gankyrin-antibody-310202415284529.jpg "Western Blot: Gankyrin Antibody [NBP1-82443] - Effects of Gankyrin knock-down on Gankyrin & POU5F1 expression. Relative Gankyrin mRNA(a) & protein (b) expression in NTera2 cells after Gankyrin knock-down. Relative POU5F1 mRNA (c) & protein (d) expression in NTera2 cells after Gankyrin knock-down. e Representative Western blot for Gankyrin & POU5F1 expression in (V) vehicle & Gankyrin siRNA (T) transfected NTera2 cells. Tubulin was used as a loading control. Data analysed by paired t-test ± SEM, ***p < 0.001, **p < 0.01. Each data point represents the mean of an individualexperiment, each with 3 replicates. Paired samples from an individual experiment are represented by the same colour. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82443_rabbit-polyclonal-gankyrin-antibody-310202415334925.jpg "Immunocytochemistry/ Immunofluorescence: Gankyrin Antibody [NBP1-82443] - Representative images for Gankyrin expression in human fetal testis & normal adult testis. Gankyrin (red), POU5F1 (green; gonocyte) & MAGE-A4 (blue; prespermatogonia) expression in A), 11 week & B) 18 week old human fetal testis, counterstained with DAPI, yellow arrows – gonocytes, white arrows – pre-spermatogonia, green arrows – differentiating gonocyte, orange arrows – Sertoli cells, Scalebars – 50 μm. C) Representative image of Gankyrin expression in normal human adult testis immunostained for SOX9 (cyan; Sertoli cells), POU5F1 (green), MAGE-A4 (blue; spermatogonia) & Gankyrin (red), Cyan arrow – spermatogonia. Scalebars – 50 μm, insets – no primary antibody controls. w-weeks. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31744479), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")