Western Blot: GABA-AR alpha 3 Antibody [NBP1-87499] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Western Blot: GABA-AR alpha 3 Antibody [NBP1-87499] - Analysis in human cell line U-87 MG.
Immunohistochemistry: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of mouse ventral pallidum shows strong labeling of synaptic fields.
Immunohistochemistry: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of mouse olfactory bulb shows labelling of both neurons and synapses.
Immunohistochemistry: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of mouse insular cortex shows strong immunoreactivity in synapses.
Immunohistochemistry: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of mouse thalamus shows strong positivity in the paraventricular thalamic nucleus.
Immunohistochemistry-Paraffin: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.
Immunohistochemistry-Paraffin: GABA-AR alpha 3 Antibody [NBP1-87499] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
This antibody was developed against Recombinant Protein corresponding to amino acids: TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for GABA-AR alpha 3 Antibody
GABA A R alpha 3
GABA(A) receptor subunit alpha-3
GABAARa3
GABRA3
gamma-aminobutyric acid (GABA) A receptor, alpha 3
gamma-aminobutyric acid receptor subunit alpha-3
gamma-animobutyric acid (GABA) A receptor, alpha 3
MGC33793
Background
Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a Cl- channel associated with the GABAA receptor (GABAA-R) subtype. GABAA-Rs are important therapeutic targets for a range of sedative, anxiolytic, and hypnotic agents and are implicated in several diseases including epilepsy, anxiety, depression, and sub-stance abuse. The GABAA-R is a multimeric subunit complex. To date six alphas, four betas and four gammas, plus alternative splicing variants of some of these subunits, have been identified (Olsen and Tobin, 1990; Whiting et al., 1999; Ogris et al., 2004). Injection in oocytes or mammalian cell lines of cRNA coding for alpha- and beta-subunits results in the expression of functional GABAA-Rs sensitive to GABA. However, coexpression of a gamma-subunit is required for benzodiazepine modulation. The various effects of the benzodiazepines in brain may also be mediated via different alpha-subunits of the receptor (McKernan et al., 2000; Mehta and Ticku, 1998; Ogris et al., 2004; P ltl et al., 2003).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for GABA-AR alpha 3 Antibody (NBP1-87499) (0)
There are no reviews for GABA-AR alpha 3 Antibody (NBP1-87499).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GABA-AR alpha 3 Antibody and receive a gift card or discount.