Home » G3BP1 » G3BP1 Proteins » G3BP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

G3BP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for G3BP1 Protein (NBP1-83404PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

G3BP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human G3BP1.

Source: E. coli

Amino Acid Sequence: FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
G3BP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83404.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for G3BP1 Recombinant Protein Antigen

  • ATP-dependent DNA helicase VIII
  • EC 3.6.1
  • EC 3.6.4.12
  • EC 3.6.4.13
  • G3BP-1
  • G3BPRas-GTPase-activating protein SH3-domain-binding protein
  • GAP binding protein
  • GAP SH3 domain-binding protein 1
  • GTPase activating protein (SH3 domain) binding protein 1
  • hDH VIII
  • HDH-VIII
  • MGC111040
  • ras GTPase-activating protein-binding protein 1
  • RasGAP-associated endoribonuclease G3BP

Background

G3BP1 encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIA1 Antibody
(OTI1D7)
NBP2-46132
Immunohistochemistry TIA1 Antibody (OTI1D7)
Immunohistochemistry TIA1 Antibody (OTI1D7)
Immunohistochemistry TIA1 Antibody (OTI1D7)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Ras-GAP Antibody
AF5094
Western Blot Ras-GAP Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
GPIP137 Antibody
NBP2-22238
Immunoprecipitation GPIP137 Antibody
Western Blot GPIP137 Antibody
Immunoprecipitation GPIP137 Antibody
(4 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
G3BP2 Antibody
NBP1-82977
Immunohistochemistry-Paraffin G3BP2 Antibody
Immunohistochemistry-Paraffin G3BP2 Antibody
Immunohistochemistry-Paraffin G3BP2 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
USP32 Antibody
NBP2-13509
Immunocytochemistry/ Immunofluorescence USP32 Antibody
Immunohistochemistry-Paraffin USP32 Antibody
Immunohistochemistry-Paraffin USP32 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
USP10 Antibody
(OTI2E1)
NBP2-01452
Immunohistochemistry-Paraffin USP10 Antibody (OTI2E1)
Western Blot USP10 Antibody (OTI2E1)
Flow Cytometry USP10 Antibody (OTI2E1)
(1 Publication)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
PABP Antibody
(10E10) - BSA Free
NB120-6125
Flow Cytometry PABP Antibody (10E10) - BSA Free
Western Blot PABP Antibody (10E10) - BSA Free
Western Blot PABP Antibody (10E10) - BSA Free
(1 Review)
(11 Publications)
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB

Galectin-3BP/MAC-2BP/L ...
AF2226
Immunocytochemistry Galectin-3BP/MAC-2BP/LGALS3BP Antibody [Unconjugated]
Western Blot Galectin-3BP/MAC-2BP/LGALS3BP Antibody [Unconjugated]
Simple Western Galectin-3BP/MAC-2BP/LGALS3BP Antibody [Unconjugated]
(2 Reviews)
(17 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NTF2 Antibody
NBP1-82520
Immunocytochemistry/ Immunofluorescence NTF2 Antibody
Immunohistochemistry-Paraffin NTF2 Antibody
Immunohistochemistry-Paraffin NTF2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ARL2BP Antibody
(OTI1A10)
NBP2-46541
Flow Cytometry ARL2BP Antibody (OTI1A10)
Immunofluorescence ARL2BP Antibody (OTI1A10)
Immunohistochemistry ARL2BP Antibody (OTI1A10)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TIAL1 Antibody
NBP1-79932
Western Blot TIAL1 Antibody
Immunocytochemistry/ Immunofluorescence TIAL1 Antibody
Immunocytochemistry/ Immunofluorescence TIAL1 Antibody
(4 Publications)
Species: Hu, Ze
Applications: ICC/IF, ISH, WB
TDP-43/TARDBP
Antibody (2E2-D3)
H00023435-M01
Western Blot TDP-43/TARDBP Antibody (2E2-D3)
Western Blot TDP-43/TARDBP Antibody (2E2-D3)
Western Blot TDP-43/TARDBP Antibody (2E2-D3)
(3 Reviews)
(211 Publications)
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
EIF2AK1 Antibody
NBP1-83210
Immunohistochemistry-Paraffin EIF2AK1 Antibody
Immunocytochemistry/ Immunofluorescence EIF2AK1 Antibody
Western Blot EIF2AK1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
RNPC3 Antibody -
BSA Free
NBP2-93867
Western Blot RNPC3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
AIF Antibody
[Unconjugated]
AF1457
Western Blot AIF Antibody [Unconjugated]
Simple Western AIF Antibody [Unconjugated]
Knockout Validated AIF Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for G3BP1 Protein (NBP1-83404PEP) (0)

There are no publications for G3BP1 Protein (NBP1-83404PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G3BP1 Protein (NBP1-83404PEP) (0)

There are no reviews for G3BP1 Protein (NBP1-83404PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for G3BP1 Protein (NBP1-83404PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional G3BP1 Products

Research Areas for G3BP1 Protein (NBP1-83404PEP)

Find related products by research area.

Blogs on G3BP1.

Check out the latest blog posts on G3BP1.
Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases
Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - PDI co-precipitates with TDP-43/TARDBP and is increased in mutant TDP-43 transgenic mouse spinal cords. Co-immunoprecipitation of wildtype and mutant Q331K TDP-43-mCherry from Neuro2a cell lysates using an anti-PDI antibody followed by TDP-43 immunoblot. Control immunoprecipitations were performed using untransfected (Untrans) or mCherry expressing cell lysates, buffer only with coprecipitating antibodies or TDP-43 Q331K cell lysates using an irrelevant, isotype-matched control antibody (IgG). Input control (2%) shows expression of mCherry-TDP43 in wildtype and Q331K cell lysates. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0081170) licensed under a CC-BY license.
TDP-43/TARDBP Antibody (2E2-D3)
H00023435-M01
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our G3BP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol G3BP1