Novus Biologicals products are now on bio-techne.com

FASTK Antibody (2B7)

Name: FASTK Antibody (2B7)
Brand: Novus Biologicals
SKU: H00010922-M02
Price: 519 USD

Submit a Review

Images

(

Enlarge)

Western Blot: FASTK Antibody (2B7) [H00010922-M02] - Analysis of FASTK expression in transfected 293T cell line by FASTK monoclonal antibody (M02), clone 2B7.Lane 1: FASTK transfected lysate(61.104 KDa).Lane 2: ...read more

Immunocytochemistry/ Immunofluorescence: FASTK Antibody (2B7) [H00010922-M02] - Analysis of monoclonal antibody to FASTK on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, ICC/IF
Clone	2B7
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FASTK Antibody (2B7) Summary

Immunogen	FASTK (NP_006703, 67 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFD
Specificity	FASTK - Fas-activated serine/threonine kinase (2B7)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	FASTK
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Immunocytochemistry/ Immunofluorescence Western Blot 1:500
Application Notes	Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FASTK Antibody (2B7)

EC 2.7.11.8
Fas-activated serine/threonine kinase
FASTFAST kinase

Background

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FoxH1 Antibody
[Unconjugated]

AF4248

(2 Publications)

Species: Hu

Applications: ICC, WB

SUB1 Antibody

NBP1-82454

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

TIA1 Antibody
(OTI1D7)

NBP2-46132

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Fas/TNFRSF6/CD95
Antibody - BSA Free

NB120-13550

Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free

Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free

(1 Review)

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

S100A9 Antibody
[Unconjugated]

AF2065

Immunohistochemistry S100A9 Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Mu

Applications: ICC, IHC, Simple Western, WB

RPP14 Antibody

NBP1-80965

Immunocytochemistry/ Immunofluorescence RPP14 Antibody

Immunohistochemistry-Paraffin RPP14 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CDK2AP2 Antibody

H00010263-B01P

Species: Hu, Mu, Rt

Applications: WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

SF3B14 Antibody

NBP1-87431

Immunohistochemistry-Paraffin SF3B14 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ROBLD3 Antibody

NBP1-71687

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

SLC6A3/DAT1
Antibody (mAb16)

NBP2-22164

Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)

(3 Reviews)

(14 Publications)

Species: Hu(-), Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Doppel Antibody

NBP2-31928

Species: Hu

Applications: IHC, IHC-P

BAAT Antibody -
BSA Free

NBP2-92503

Immunohistochemistry-Paraffin BAAT Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence BAAT Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(803 Publications)

Species: Hu

Applications: BA

PTPLA
Overexpression Lysate

NBL1-14964

Species: Hu

Applications: WB

CAP1 Antibody

NBP1-86644

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Calpastatin
Antibody (OTI1E7)

NBP2-01819

Western Blot Calpastatin Antibody (OTI1E7)

Immunohistochemistry-Paraffin Calpastatin Antibody (OTI1E7)

Species: Hu

Applications: Flow, IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Publications for FASTK Antibody (H00010922-M02) (0)

There are no publications for FASTK Antibody (H00010922-M02).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FASTK Antibody (H00010922-M02) (0)

There are no reviews for FASTK Antibody (H00010922-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

ICC/IF Video Protocol

FAQs for FASTK Antibody (H00010922-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional FASTK Products

Research Areas for FASTK Antibody (H00010922-M02)

Find related products by research area.

Apoptosis

Blogs on FASTK

There are no specific blogs for FASTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our FASTK Antibody (2B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol	FASTK
Entrez	10922(Human)
Uniprot	NP_006703(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

FASTK Antibody (2B7)

Species Glossary

Images

Product Details

Order Details

FASTK Antibody (2B7) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for FASTK Antibody (2B7)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FASTK Antibody (H00010922-M02) (0)

Reviews for FASTK Antibody (H00010922-M02) (0)

Product General Protocols

Video Protocols

FAQs for FASTK Antibody (H00010922-M02) (0)

Secondary Antibodies

Isotype Controls

Additional FASTK Products

Research Areas for FASTK Antibody (H00010922-M02)

Blogs on FASTK

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics