Novus Biologicals products are now on bio-techne.com

EVA1/MPZL2 Recombinant Protein Antigen

Images

 
There are currently no images for EVA1/MPZL2 Protein (NBP2-31836PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

EVA1/MPZL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPZL2.

Source: E. coli

Amino Acid Sequence: VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MPZL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31836.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EVA1/MPZL2 Recombinant Protein Antigen

  • EVA1
  • EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2
  • MPZL2
  • myelin protein zero-like 2

Background

Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-79280
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-85540
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-85297
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46069
Species: Hu, Mu, Rt
Applications: WB
NBP1-87730
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-74210
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-P, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for EVA1/MPZL2 Protein (NBP2-31836PEP) (0)

There are no publications for EVA1/MPZL2 Protein (NBP2-31836PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVA1/MPZL2 Protein (NBP2-31836PEP) (0)

There are no reviews for EVA1/MPZL2 Protein (NBP2-31836PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EVA1/MPZL2 Protein (NBP2-31836PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EVA1/MPZL2 Products

Blogs on EVA1/MPZL2

There are no specific blogs for EVA1/MPZL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EVA1/MPZL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MPZL2