Novus Biologicals products are now on bio-techne.com

Endomucin/Mucin -14 Recombinant Protein Antigen

Name: Endomucin/Mucin -14 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-92150PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Endomucin/Mucin -14 Protein (NBP1-92150PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Endomucin/Mucin -14 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EMCN. Source: E. coli Amino Acid Sequence: EAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	EMCN
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92150. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Endomucin/Mucin -14 Recombinant Protein Antigen

EMCN
EMCN2
Endomucin
MUC-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD31/PECAM-1
Antibody [Unconjugate

AF3628

Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]

(6 Reviews)

(503 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Hemoglobin alpha
Antibody - BSA Free

NB110-41083

(12 Publications)

Species: Hu

Applications: ChIP, ELISA, ICC/IF, WB

CD34 Antibody
[Unconjugated]

AF4117

(3 Reviews)

(37 Publications)

Species: Rt

Applications: IHC, WB

IGFBP-rp1/IGFBP-7
Antibody [Unconjugate ...

AF1334

Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]

(13 Publications)

Species: Hu

Applications: IHC, WB

CD45 Antibody
[Unconjugated]

AF114

Immunocytochemistry CD45 Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]

(1 Review)

(70 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, ICC, IHC, WB

CD117/c-kit
Antibody [Unconjugate

AF1356

Western Blot CD117/c-kit Antibody [Unconjugated]

Immunohistochemistry CD117/c-kit Antibody [Unconjugated]

(4 Reviews)

(116 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(389 Publications)

Species: Hu, Mu

Applications: ICC, IHC

GATA-2 Antibody
[Unconjugated]

AF2046

Simple Western GATA-2 Antibody [Unconjugated]

(11 Publications)

Species: Hu, Mu

Applications: ICC, IHC, Simple Western, WB

Vinculin Antibody
(728526) [Unconjugate ...

MAB6896

Western Blot Vinculin Antibody (728526) [Unconjugated]

Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]

(3 Reviews)

(19 Publications)

Species: Hu, Mu, Rt

Applications: IHC, Simple Western, WB

Fucosyltransferase
1/FUT1 Antibody

NBP3-35576

Species: Hu, Mu, Rt

Applications: ELISA, WB

Norrin/NDP
Antibody [Unconjugate

AF3014

(6 Publications)

Species: Hu

Applications: Block, IHC, WB

OSGEP Antibody
(OTI9E3)

NBP2-00823

Immunohistochemistry-Paraffin OSGEP Antibody (OTI9E3)

(2 Publications)

Species: Ca, Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

Carbohydrate
Sulfotransferase 4/CH ...

AF5357

Species: Hu

Applications: IP, Neut, WB

Endoglin/CD105
Antibody [Unconjugate

AF1320

Simple Western Endoglin/CD105 Antibody [Unconjugated]

(2 Reviews)

(44 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

L-Selectin/CD62L
Antibody (4G8) [Uncon ...

BBA24

(9 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow

Integrin alpha
2b/CD41 Antibody (745 ...

MAB7616

Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]

(6 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, WB

Publications for Endomucin/Mucin -14 Protein (NBP1-92150PEP) (0)

There are no publications for Endomucin/Mucin -14 Protein (NBP1-92150PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endomucin/Mucin -14 Protein (NBP1-92150PEP) (0)

There are no reviews for Endomucin/Mucin -14 Protein (NBP1-92150PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Endomucin/Mucin -14 Protein (NBP1-92150PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Endomucin/Mucin -14 Products

Research Areas for Endomucin/Mucin -14 Protein (NBP1-92150PEP)

Find related products by research area.

Blogs on Endomucin/Mucin -14

There are no specific blogs for Endomucin/Mucin -14, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

CD31/PECAM-1 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Goat Anti-Human/Mouse/Rat CD31/PECAM-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3628) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; NL001) and counterstained with DAPI (blue). Specific staining was localized to developing endothelium. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.

CD31/PECAM-1 Antibody [Unconjugated]
AF3628

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Endomucin/Mucin -14 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

EMCN

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Endomucin/Mucin -14 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Endomucin/Mucin -14 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Endomucin/Mucin -14 Recombinant Protein Antigen

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Endomucin/Mucin -14 Protein (NBP1-92150PEP) (0)

Reviews for Endomucin/Mucin -14 Protein (NBP1-92150PEP) (0)

FAQs for Endomucin/Mucin -14 Protein (NBP1-92150PEP) (0)

Additional Endomucin/Mucin -14 Products

Research Areas for Endomucin/Mucin -14 Protein (NBP1-92150PEP)

Blogs on Endomucin/Mucin -14

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics