ENC1 Antibody (3C10) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL |
Specificity |
ENC1 - ectodermal-neural cortex (with BTB-like domain) (3C10) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ENC1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ENC1 Antibody (3C10)
Background
DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. (1997) [PubMed 9305847] used serial analysis of gene expression (SAGE) to evaluate cellular mRNA levels in a colorectal cancer cell line transfected with p53. Of 7,202 transcripts identified, only 14 were expressed at levels more than 10-fold higher in p53-expressing cells than in control cells. Polyak et al. (1997) [PubMed 9305847] termed these genes 'p53-induced genes,' or PIGs, several of which were predicted to encode redox-controlling proteins. They noted that reactive oxygen species (ROS) are potent inducers of apoptosis. Flow cytometric analysis showed that p53 expression induces ROS production, which increases as apoptosis progresses under some conditions. The authors stated that the PIG10 gene, also called ENC1, encodes an actin-binding protein.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: BA
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC, IHC-Fr, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
Species: Fe, Hu, RM
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA, BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Mu
Applications: ELISA
Publications for ENC1 Antibody (H00008507-M03) (0)
There are no publications for ENC1 Antibody (H00008507-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ENC1 Antibody (H00008507-M03) (0)
There are no reviews for ENC1 Antibody (H00008507-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ENC1 Antibody (H00008507-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ENC1 Products
Research Areas for ENC1 Antibody (H00008507-M03)
Find related products by research area.
|
Blogs on ENC1