Novus Biologicals products are now on bio-techne.com

eIF2A Recombinant Protein Antigen

Name: eIF2A Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84879PEP
Price: 289 USD

Images

There are currently no images for eIF2A Protein (NBP1-84879PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

eIF2A Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF2A. Source: E. coli Amino Acid Sequence: VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	EIF2A
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84879. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF2A Recombinant Protein Antigen

EIF-2
EIF-2A
EIF2AEIF2
EIF-2alpha
eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
subunit 1 (alpha, 35kD )

Background

The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kD), beta (38 kD, MIM 603908), and gamma (52 kD, MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha (Ernst et al., 1987 [PubMed 2948954]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PERK Antibody
[Unconjugated]

AF3999

Knockout Validated PERK Antibody [Unconjugated]

(7 Publications)

Species: Hu

Applications: KO, WB

ATF6 Antibody
(70B1413.1) - BSA Fre

NBP1-40256

Flow (Intracellular) ATF6 Antibody (70B1413.1) - BSA Free

Immunohistochemistry-Paraffin ATF6 Antibody (70B1413.1) - BSA Free

(3 Reviews)

(246 Publications)

Species: Hu, Mu, Pl, Po, Rb, Rt

Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB

GADD153/CHOP
Antibody (9C8)

NB600-1335

Flow Cytometry GADD153/CHOP Antibody (9C8)

Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)

(3 Reviews)

(46 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

GRP78/HSPA5
Antibody - BSA Free

NBP1-06274

Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free

(2 Reviews)

(44 Publications)

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze

Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

PKR Antibody - BSA
Free

NBP1-77266

Immunohistochemistry PKR Antibody - BSA Free

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

PKLR Antibody
[Unconjugated]

AF8519

Simple Western PKLR Antibody [Unconjugated]

Species: Hu, Mu, Rt

Applications: Simple Western, WB

eIF2 alpha/EIF2S1
Antibody (OTI3H4)

NBP2-02669

Western Blot eIF2 alpha/EIF2S1 Antibody (OTI3H4)

Immunohistochemistry-Paraffin eIF2 alpha/EIF2S1 Antibody (OTI3H4)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(389 Publications)

Species: Hu, Mu

Applications: ICC, IHC

XBP1 Antibody -
BSA Free

NBP1-77681

(18 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB

IRE1 alpha [p
Ser724] Antibody - BS ...

NB100-2323

Western Blot IRE1 alpha [p Ser724] Antibody - BSA Free

(9 Reviews)

(337 Publications)

Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt

Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, Simple Western, WB

eIF4E [p Ser209]
Antibody

NB100-81898

Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody

Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody

(1 Publication)

Species: Hu, Po

Applications: ICC/IF, IHC, IHC-P, WB

GADD34 Antibody

NB100-778

Immunocytochemistry/ Immunofluorescence GADD34 Antibody

(1 Review)

(3 Publications)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

PEDFR/PNPLA2/ATGL
Antibody [Unconjugate ...

AF5365

Simple Western PEDFR/PNPLA2/ATGL Antibody [Unconjugated]

Immunohistochemistry PEDFR/PNPLA2/ATGL Antibody [Unconjugated]

(10 Publications)

Species: Hu, Mu, Rt

Applications: IHC, Simple Western, WB

eEF-2 Antibody
(4E2Z5)

NBP3-16866

Immunocytochemistry/ Immunofluorescence eEF-2 Antibody (4E2Z5)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Syntaxin-BP1
Antibody [Unconjugate

AF5675

Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]

Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]

Species: Hu, Mu, Rt

Applications: IHC, IP, KO, WB

LEF1 Antibody (3H5)

H00051176-M01

(3 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB

Methionine
Aminopeptidase 2/META ...

NBP3-05513

Immunohistochemistry-Paraffin Methionine Aminopeptidase 2/METAP2 Antibody

Western Blot Methionine Aminopeptidase 2/METAP2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

E2F-1 Antibody
(JJ092-02)

NBP2-67899

Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for eIF2A Protein (NBP1-84879PEP) (0)

There are no publications for eIF2A Protein (NBP1-84879PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF2A Protein (NBP1-84879PEP) (0)

There are no reviews for eIF2A Protein (NBP1-84879PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF2A Protein (NBP1-84879PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF2A Products

Research Areas for eIF2A Protein (NBP1-84879PEP)

Find related products by research area.

Blogs on eIF2A.

Check out the latest blog posts on eIF2A.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni... Read full blog post.

PKR - Mediating cellular stress responses through multiple signaling pathways
Protein kinase R (PKR) is an intracellular stress-sensing protein that is able to detect and respond to viral infections. While PKR is able to sense and respond to a variety of signals, dsRNA is a well-characterized ligand. dsRNA produced during v... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

IRE1 (pS724) was detected in immersion fixed paraffin-embedded sections of human spleen using Rabbit Anti-Human IRE1 (pS724) polyclonal Antibody (Catalog # NB100-2323) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the perinuclear cytoplasm in splenocytes.

IRE1 alpha [p Ser724] Antibody - BSA Free
NB100-2323

Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY license.

ATF6 Antibody (70B1413.1) - BSA Free
NBP1-40256-0.1mg

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our eIF2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

EIF2A

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

eIF2A Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

eIF2A Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for eIF2A Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for eIF2A Protein (NBP1-84879PEP) (0)

Reviews for eIF2A Protein (NBP1-84879PEP) (0)

FAQs for eIF2A Protein (NBP1-84879PEP) (0)

Additional eIF2A Products

Research Areas for eIF2A Protein (NBP1-84879PEP)

Blogs on eIF2A.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics