Novus Biologicals products are now on bio-techne.com

DYRK2 Recombinant Protein Antigen

Name: DYRK2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-58747PEP
Price: 289 USD

Images

There are currently no images for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

DYRK2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DYRK2. Source: E. coli Amino Acid Sequence: IALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DYRK2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58747. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DYRK2 Recombinant Protein Antigen

dual specificity tyrosine-phosphorylation-regulated kinase 2
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
DYRK2
EC 2.7.12
EC 2.7.12.1
FLJ21217
FLJ21365

Background

DYRK2, or dual specificity tyrosine-phosphorylation-regulated kinase 2, has a role in the regulation of cellular growth and/or development. In response to DNA damage, DYRK2 regulates p53 phosphorylation on Ser-46 to induce apoptosis. DYRK2 has been proposed to inactivate GYS1 by phosphorylation at Ser-641, and potentially a second phosphorylation site, thus regulating glycogen synthesis. DYRK2 also phosphorylates EIF2B5 at Ser-544, enabling its subsequent phosphorylation and inhibition by GSK3, and may play a more general role in the priming of GSK3 substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DYRK1A Antibody
(7D10) - Azide and BS ...

H00001859-M01

(66 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, Func, ICC/IF, IHC, IHC-Fr, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(43 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

DYRK3 Antibody

AF5409

Species: Hu, Mu, Rt

Applications: WB

Dyrk1B Antibody -
BSA Free

NBP1-33464

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, WB

Cyclin D1 Antibody
(SPM587)

NBP2-32840

Flow Cytometry Cyclin D1 Antibody (SPM587)

(1 Review)

(9 Publications)

Species: Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

MDM2/HDM2 Antibody
(SMP14) - BSA Free

NB100-2736

Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free

(1 Review)

(22 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, IP, WB

DYRK4 Antibody -
BSA Free

NBP1-89511

Immunohistochemistry-Paraffin DYRK4 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(48 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

Cdk5 Antibody -
BSA Free

NBP2-15843

Immunohistochemistry-Paraffin Cdk5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Cdk5 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

Craniofacial
Development Protein 1 ...

NBP2-43772

Immunocytochemistry/ Immunofluorescence Craniofacial Development Protein 1 Antibody (11811) - Azide and BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Retinoblastoma
binding protein 1 Ant ...

NBP1-26616

Immunoprecipitation Retinoblastoma binding protein 1 Antibody - BSA Free

Species: Hu

Applications: IP, WB

SNW1 Antibody -
BSA Free

NBP1-88523

Immunohistochemistry-Paraffin SNW1 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

GSG2 Antibody

NBP3-35922

Species: Hu, Mu

Applications: ELISA, WB

CRMP4 Antibody -
BSA Free

NBP1-85447

Immunohistochemistry-Paraffin CRMP4 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

LIM kinase 2
Antibody - BSA Free

NBP1-85783

(2 Publications)

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

WDR68 Antibody -
Azide and BSA Free

NBP2-95210

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PYK2/FAK2 [p
Tyr402] Antibody (592 ...

MAB6210

Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]

(1 Review)

(1 Publication)

Species: Hu

Applications: Simple Western, WB

GADD153/CHOP
Antibody (9C8) - BSA

NB600-1335

Flow Cytometry GADD153/CHOP Antibody (9C8) - BSA Free

Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8) - BSA Free

(3 Reviews)

(47 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

DYRK2 Recombinant
Protein Antigen

NBP2-58747PEP

Species: Hu

Applications: AC

Publications for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP) (0)

There are no publications for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP) (0)

There are no reviews for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DYRK2 Products

Research Areas for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP)

Find related products by research area.

Blogs on DYRK2

There are no specific blogs for DYRK2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our DYRK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DYRK2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

DYRK2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DYRK2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DYRK2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP) (0)

Reviews for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP) (0)

FAQs for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP) (0)

Additional DYRK2 Products

Research Areas for DYRK2 Recombinant Protein Antigen (NBP2-58747PEP)

Blogs on DYRK2

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics