![Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody [NBP2-14296] - Staining of human seminal vesicle shows high expression.](http://images.novusbio.com/fullsize/DOG1-TMEM16A-Antibody-Immunohistochemistry-Paraffin-NBP2-14296-img0004.jpg "Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody [NBP2-14296] - Staining of human seminal vesicle shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ANO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ANO1 |
![Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody [NBP2-14296] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/DOG1-TMEM16A-Antibody-Immunohistochemistry-Paraffin-NBP2-14296-img0003.jpg "Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody [NBP2-14296] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody [NBP2-14296] - Staining in human seminal vesicle and lymph node tissues using anti-ANO1 antibody. Corresponding ANO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DOG1-TMEM16A-Antibody-Immunohistochemistry-Paraffin-NBP2-14296-img0005.jpg "Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody [NBP2-14296] - Staining in human seminal vesicle and lymph node tissues using anti-ANO1 antibody. Corresponding ANO1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Western_Blot_20935.jpg)
![Immunohistochemistry PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Immunohistochemistry_6673.jpg)
![Neutralization PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Block_Neutralize_8750.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")