Reactivity | HuSpecies Glossary |
Applications | IHC |
Clone | DG1/447 + DOG-1.1 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | IHC-Prediluted |
Description | The prediluted antibody does not require any mixing, dilution, reconstitution, or titration; the antibody is ready-to-use and optimized for staining. |
Immunogen | Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6) |
Localization | Cell Surface and Cytoplasmic |
Marker | Marker for Gastrointestinal Stromal Tumors |
Isotype | IgG1 Kappa/IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | ANO1 |
Purity | Protein A or G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes. Optimal dilution for a specific application should be determined. |
Storage | Store at 4C. |
Buffer | 10 mM PBS with 0.05% BSA |
Preservative | 0.05% Sodium Azide |
Purity | Protein A or G purified |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ANO1 |