Reactivity | HuSpecies Glossary |
Applications | IHC |
Clone | DG1/447 + DOG-1.1 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | HRP |
Description | This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet. |
Immunogen | Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6) |
Localization | Cell Surface and Cytoplasmic |
Marker | Marker for Gastrointestinal Stromal Tumors |
Isotype | IgG1 Kappa/IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | ANO1 |
Purity | Protein A or G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C in the dark. |
Buffer | PBS |
Preservative | No Preservative |
Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ANO1 |