Reactivity | HuSpecies Glossary |
Applications | IHC |
Clone | DG1/447 + DOG-1.1 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Concentration | 1.0 mg/ml |
Description | 1.0 mg/ml of antibody purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS WITHOUT BSA & azide. Also available at 200 ug/ml WITH BSA & azide (NBP2-34285). Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C. |
Immunogen | Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6) |
Localization | Cell Surface and Cytoplasmic |
Marker | Marker for Gastrointestinal Stromal Tumors |
Isotype | IgG1 Kappa/IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | ANO1 |
Purity | Protein A or G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes. Optimal dilution for a specific application should be determined. |
Theoretical MW | 114 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20 to -80C. Avoid freeze-thaw cycles. |
Buffer | 10 mM PBS |
Preservative | No Preservative |
Concentration | 1.0 mg/ml |
Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ANO1 |