![Western Blot: DNAJC19 Antibody [H00131118-B01P] - Analysis of DNAJC19 expression in K-562.](http://images.novusbio.com/fullsize/DNAJC19-Antibody-Western-Blot-H00131118-B01P-img0003.jpg "Western Blot: DNAJC19 Antibody [H00131118-B01P] - Analysis of DNAJC19 expression in K-562.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | DNAJC19 (NP_660304.1, 1 a.a. - 116 a.a.) full-length human protein. MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
| Specificity | DNAJC19 - DnaJ (Hsp40) homolog, subfamily C, member 19, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | DNAJC19 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNAJC19 Antibody (H00131118-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNAJC19 |
| Entrez |
|
| Uniprot |
|
![Western Blot: DNAJC19 Antibody [H00131118-B01P] - Analysis of DNAJC19 expression in transfected 293T cell line by DNAJC19 polyclonal antibody. Lane1:DNAJC19 transfected lysate(12.76 KDa). Lane2:Non-transfected lysate.](http://images.novusbio.com/fullsize/DNAJC19-Antibody-Western-Blot-H00131118-B01P-img0004.jpg "Western Blot: DNAJC19 Antibody [H00131118-B01P] - Analysis of DNAJC19 expression in transfected 293T cell line by DNAJC19 polyclonal antibody. Lane1:DNAJC19 transfected lysate(12.76 KDa). Lane2:Non-transfected lysate.")
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")