Home » DIRAS3 » DIRAS3 Proteins » DIRAS3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DIRAS3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DIRAS3 Protein (NBP1-90106PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DIRAS3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DIRAS3.

Source: E. coli

Amino Acid Sequence: SDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DIRAS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90106.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DIRAS3 Recombinant Protein Antigen

  • DIRAS family, GTP-binding RAS-like 3
  • Distinct subgroup of the Ras family member 3
  • NOEY2member I
  • RHOI
  • Rho-related GTP-binding protein RhoI

Background

The ARHI gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells but not inovarian and breast cancers. It is a maternally imprinted gene and its expression is associated with growthsuppression. Thus, this gene a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Cyclin D1 Antibody
NBP2-24695
Western Blot Cyclin D1 Antibody
Immunohistochemistry-Paraffin Cyclin D1 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
SLC12A9 Antibody
NBP2-68858
Immunohistochemistry-Paraffin SLC12A9 Antibody
Species: Hu
Applications: IHC, IHC-P
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(840 Publications)
Species: Hu
Applications: BA
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
PAK3 Antibody
[Unconjugated]
AF6897
Western Blot PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IHC, Simple Western, WB
LRPAP Antibody
NBP1-89334
Immunocytochemistry/ Immunofluorescence LRPAP Antibody
Immunohistochemistry-Paraffin LRPAP Antibody
Immunohistochemistry LRPAP Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
E2F-1 Antibody
(JJ092-02)
NBP2-67899
Flow Cytometry E2F-1 Antibody (JJ092-02)
Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)
Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
PEG3 Antibody
NBP2-47624
Immunocytochemistry/ Immunofluorescence PEG3 Antibody
Immunohistochemistry-Paraffin PEG3 Antibody
Western Blot PEG3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
E2F-4 Antibody
NBP1-21374
Immunoprecipitation E2F-4 Antibody
Knockdown Validated E2F-4 Antibody
Immunohistochemistry-Paraffin E2F-4 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
HDAC9 Antibody
(OTI7G2)
NBP2-45952
Immunohistochemistry HDAC9 Antibody (OTI7G2)
Immunohistochemistry HDAC9 Antibody (OTI7G2)
Immunohistochemistry HDAC9 Antibody (OTI7G2)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DIRAS3 Recombinant
Protein Antigen
NBP1-90106PEP
DIRAS3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DIRAS3 Protein (NBP1-90106PEP) (0)

There are no publications for DIRAS3 Protein (NBP1-90106PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIRAS3 Protein (NBP1-90106PEP) (0)

There are no reviews for DIRAS3 Protein (NBP1-90106PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DIRAS3 Protein (NBP1-90106PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DIRAS3 Products

Research Areas for DIRAS3 Protein (NBP1-90106PEP)

Find related products by research area.

Blogs on DIRAS3.

Check out the latest blog posts on DIRAS3.
ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DIRAS3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DIRAS3