![Immunocytochemistry/Immunofluorescence: DGK-zeta Antibody [NBP2-13918] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DGK-zeta-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13918-img0004.jpg "Immunocytochemistry/Immunofluorescence: DGK-zeta Antibody [NBP2-13918] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE |
| Predicted Species | Mouse (92%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DGKZ |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot IL-33 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-33_AF3626_Western_Blot_11104.jpg)
![Neutralization IL-33 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL33_AF3626_Block_Neutralize_16781.jpg)
![Immunohistochemistry IL-33 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL33_AF3626_ELISA_Capture_17376.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DGK-zeta Antibody (NBP2-13918)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DGKZ |
![Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human liver shows no positivity in hepatocytes.](http://images.novusbio.com/fullsize/DGK-zeta-Antibody-Immunohistochemistry-Paraffin-NBP2-13918-img0009.jpg "Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human liver shows no positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/DGK-zeta-Antibody-Immunohistochemistry-Paraffin-NBP2-13918-img0001.jpg "Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human lymph node shows moderate cytoplasmic positivity in non - germinal center cells.](http://images.novusbio.com/fullsize/DGK-zeta-Antibody-Immunohistochemistry-Paraffin-NBP2-13918-img0005.jpg "Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human lymph node shows moderate cytoplasmic positivity in non - germinal center cells.")
![Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/DGK-zeta-Antibody-Immunohistochemistry-Paraffin-NBP2-13918-img0006.jpg "Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human small intestine shows weak cytoplasmic positivity in lymphoid tissue.](http://images.novusbio.com/fullsize/DGK-zeta-Antibody-Immunohistochemistry-Paraffin-NBP2-13918-img0007.jpg "Immunohistochemistry-Paraffin: DGK-zeta Antibody [NBP2-13918] - Staining of human small intestine shows weak cytoplasmic positivity in lymphoid tissue.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")