DFNB31 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse DFNB31 (NP_001008791.1). Peptide sequence VLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSARER |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
WHRN |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for DFNB31 Antibody
Background
DFNB31 (deafness autosomal recessive 31) is a PDZ scaffold protein which is necessary for elongation and maintenance of stereocilia in the inner and outer hair cells in the organ of Corti in the inner ear. It is also expressed in retinal photoreceptor cells. Mutations in this gene, also known as Whirlin, are associated with non syndromic sensorineural deafness autosomal recessive type 31 and retinitis pigmentosa. DFNB31 interacts with a calmodulin dependent serine kinase, CASK, and may be involved in the formation of scaffolding protein complexes that facilitate synaptic transmission in the central nervous system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu
Applications: IHC, IHC-P, WB
Publications for DFNB31 Antibody (NBP3-10840) (0)
There are no publications for DFNB31 Antibody (NBP3-10840).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DFNB31 Antibody (NBP3-10840) (0)
There are no reviews for DFNB31 Antibody (NBP3-10840).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DFNB31 Antibody (NBP3-10840) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DFNB31 Products
Research Areas for DFNB31 Antibody (NBP3-10840)
Find related products by research area.
|
Blogs on DFNB31