Home » Derlin 1 » Derlin 1 Proteins » Derlin 1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Derlin 1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Derlin 1 Protein (NBP1-88023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Derlin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DERL1.

Source: E. coli

Amino Acid Sequence: LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DERL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Derlin 1 Recombinant Protein Antigen

  • DER-1
  • DER1Degradation in endoplasmic reticulum protein 1
  • Der1-like domain family, member 1
  • Der1-like protein 1
  • derlin-1
  • DERtrin-1
  • FLJ13784
  • FLJ42092
  • MGC3067
  • PRO2577

Background

Degradation in Endoplasmic Reticulum protein 1 (Derlin1) is a channel-like protein, found in the ER membrane, responsible for degrading and funneling misfolded proteins and other cellular debris into the appropriate degradative pathways within the cell. Specifically, Derlin-1 is thought to form a channel to allow retrotranslocation of misfolded proteins into the cytosol where they may be ubiquitinated and degraded by the proteasome.

Derlin 1 antibodies will serve as useful tools for protein degradation studies and for research on certian types of cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p97/VCP Antibody
NB100-1558
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
(12 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Proteasome 19S 10B
Antibody
NB100-1483
Western Blot Proteasome 19S 10B Antibody
Immunocytochemistry/ Immunofluorescence Proteasome 19S 10B Antibody
Flow Cytometry Proteasome 19S 10B Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
HRD1 Antibody -
BSA Free
NB100-2526
Immunohistochemistry-Paraffin HRD1 Antibody - BSA Free
Western Blot HRD1 Antibody - BSA Free
Western Blot HRD1 Antibody - BSA Free
(3 Reviews)
(15 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Gemin 4 Antibody
NB110-40591
Western Blot Gemin 4 Antibody
Immunohistochemistry-Paraffin Gemin 4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Craniofacial
Development Protein 1 ...
NBP2-43772
Immunohistochemistry-Paraffin Craniofacial Development Protein 1 Antibody (11811)
Immunohistochemistry-Paraffin Craniofacial Development Protein 1 Antibody (11811)
Immunocytochemistry/ Immunofluorescence Craniofacial Development Protein 1 Antibody (11811)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DAP5 Antibody
NBP1-85311
Western Blot DAP5 Antibody
Western Blot DAP5 Antibody
Immunohistochemistry-Paraffin DAP5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
Derlin-2 Antibody
NBP2-47485
Western Blot Derlin-2 Antibody
Immunohistochemistry-Paraffin Derlin-2 Antibody
Immunohistochemistry-Paraffin Derlin-2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
SELS Antibody
NBP1-89558
Immunocytochemistry/ Immunofluorescence SELS Antibody
Western Blot SELS Antibody
Immunohistochemistry-Paraffin SELS Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(44 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Recombinant Human
Derlin-3 GST (N-Term) ...
H00091319-P01
Other Recombinant Human Derlin-3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
SEL1L Antibody -
Azide and BSA Free
NBP2-93746
Immunocytochemistry/ Immunofluorescence SEL1L Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SEL1L Antibody - Azide and BSA Free
Western Blot SEL1L Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
UFD1L Antibody
(7K8E2)
NBP3-33259
Western Blot UFD1L Antibody (7K8E2)
Species: Hu, Mu, Rt
Applications: ELISA, WB
Recombinant Human
EDEM1 GST (N-Term) Pr ...
H00009695-Q01
SDS-PAGE Recombinant Human EDEM1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
HERPUD1 Antibody
(OTI1A2)
NBP2-45970
Immunocytochemistry/ Immunofluorescence HERPUD1 Antibody (OTI1A2)
Immunohistochemistry HERPUD1 Antibody (OTI1A2)
Immunohistochemistry HERPUD1 Antibody (OTI1A2)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB

Publications for Derlin 1 Protein (NBP1-88023PEP) (0)

There are no publications for Derlin 1 Protein (NBP1-88023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Derlin 1 Protein (NBP1-88023PEP) (0)

There are no reviews for Derlin 1 Protein (NBP1-88023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Derlin 1 Protein (NBP1-88023PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Derlin 1 Products

Research Areas for Derlin 1 Protein (NBP1-88023PEP)

Find related products by research area.

Blogs on Derlin 1

There are no specific blogs for Derlin 1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Derlin 1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DERL1