Novus Biologicals products are now on bio-techne.com

DDOST Recombinant Protein Antigen

Name: DDOST Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38681PEP
Price: 289 USD

Images

There are currently no images for DDOST Protein (NBP2-38681PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DDOST Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDOST. Source: E. coli Amino Acid Sequence: LVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DDOST
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38681. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDOST Recombinant Protein Antigen

advanced glycation endproduct receptor 1
DDOST 48 kDa subunit
dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
dolichyl-diphosphooligosaccharide-protein glycosyltransferase
dolichyl-diphosphooligosaccharide--protein glycosyltransferase
dolichyl-diphosphooligosaccharide-protein glycotransferase
EC 2.4.1.119
KIAA0115MGC2191
Oligosaccharyl transferase 48 kDa subunit
oligosaccharyltransferase 48 kDa subunit
OST48AGER1
OSTOKSWcl45
WBP1

Background

DDOST encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ribophorin I
Antibody (OTI3H3)

NBP2-01294

Western Blot Ribophorin I Antibody (OTI3H3)

Immunocytochemistry/ Immunofluorescence Ribophorin I Antibody (OTI3H3)

(2 Reviews)

(1 Publication)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Ribophorin II
Antibody

NBP1-80835

Immunohistochemistry-Paraffin Ribophorin II Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

DAD1 Antibody -
BSA Free

NBP1-77197

(1 Publication)

Species: Hu, Mu

Applications: ELISA, ICC/IF, WB

Bestrophin 1
Antibody (E6-6) - BSA

NB300-164

Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free

(1 Review)

(49 Publications)

Species: Ca, Hu, Mu, Po, Pm, Rt(-)

Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB

Dystrophin Antibody

NBP1-89953

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

Osteocalcin
Antibody (190125)

MAB1419

Immunocytochemistry Osteocalcin Antibody (190125)

(3 Reviews)

(56 Publications)

Species: Hu, Rt

Applications: CyTOF-ready, ICC, IHC, ICFlow

RENBP Antibody

NBP1-80851

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

OSTalpha Antibody

NBP1-57085

(2 Publications)

Species: Hu, Rt

Applications: WB

MID1 Antibody

NBP1-26612

(2 Publications)

Species: Hu

Applications: IP (-), WB

Recombinant Human
KRTCAP2 GST (N-Term) ...

H00200185-P01

Species: Hu

Applications: ELISA, AP, PA, WB

STT3A Antibody
(4D4)

H00003703-M02

Immunohistochemistry-Paraffin STT3A Antibody (4D4)

(5 Publications)

Species: Hu

Applications: ELISA, IHC, IHC-P, IP, WB

PTH Antibody
(918462) [Unconjugate

MAB7665

Western Blot PTH Antibody (918462) [Unconjugated]

Species: Hu

Applications: IHC, WB

CDC42 Antibody
(JJ086-04)

NBP2-67895

Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, IP, WB

FXR/NR1H4 Antibody
(A9033A) [Unconjugate ...

PP-A9033A-00

(2 Reviews)

(14 Publications)

Species: Hu

Applications: DirELISA, IHC, IP, WB

IGF-I/IGF-1
[Unconjugated]

291-G1

Mass Spectrometry IGF-I/IGF-1 [Unconjugated]

(224 Publications)

Species: Hu

Applications: BA

AGER [HRP]

DRG00

(82 Publications)

Species: Hu

Applications: ELISA

RhoA Antibody

NB100-91273

Immunohistochemistry-Paraffin RhoA Antibody

(1 Review)

(5 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

SHC1 Antibody
(OTI3A1)

NBP2-02434

Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

RhoD Antibody

NBP1-58359

Species: Hu

Applications: IHC, IHC-P, WB

DDOST Recombinant
Protein Antigen

NBP2-38681PEP

Species: Hu

Applications: AC

Publications for DDOST Protein (NBP2-38681PEP) (0)

There are no publications for DDOST Protein (NBP2-38681PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDOST Protein (NBP2-38681PEP) (0)

There are no reviews for DDOST Protein (NBP2-38681PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DDOST Protein (NBP2-38681PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDOST Products

Blogs on DDOST

There are no specific blogs for DDOST, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our DDOST Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DDOST

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

DDOST Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DDOST Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DDOST Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DDOST Protein (NBP2-38681PEP) (0)

Reviews for DDOST Protein (NBP2-38681PEP) (0)

FAQs for DDOST Protein (NBP2-38681PEP) (0)

Additional DDOST Products

Blogs on DDOST

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics