![Western Blot: Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody [NBP3-11010] - Western blot analysis of Cytosolic Sulfotransferase 1A1/SULT1A1 in Mouse Spleen lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/fullsize/Cytosolic-Sulfotransferase-1A1-SULT1A1-Antibody-Western-Blot-NBP3-11010-img0001.jpg "Western Blot: Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody [NBP3-11010] - Western blot analysis of Cytosolic Sulfotransferase 1A1/SULT1A1 in Mouse Spleen lysates. Antibody dilution at 1ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse Cytosolic Sulfotransferase 1A1/SULT1A1. Peptide sequence KVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSL |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SULT1A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SULT1A1 |
![Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Western_Blot_11615.jpg)
![Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Immunohistochemistry_11705.jpg)
![Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Flow_Cytometry_11747.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")