Home » CYP27A1 » CYP27A1 Proteins » CYP27A1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CYP27A1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CYP27A1 Protein (NBP2-32433PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CYP27A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP27A1.

Source: E. coli

Amino Acid Sequence: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP27A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32433.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CYP27A1 Recombinant Protein Antigen

  • 12-alpha-triol 27-hydroxylase
  • 7-alpha
  • cholestanetriol 26-monooxygenase
  • CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
  • CTX5-beta-cholestane-3-alpha
  • CYP27
  • CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
  • CYP27A1
  • Cytochrome P450 27
  • cytochrome P450, family 27, subfamily A, polypeptide 1
  • cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1
  • Cytochrome P-450C27/25
  • EC 1.14.13.15
  • EC 1.14.15.15
  • sterol 26-hydroxylase, mitochondrial
  • Sterol 27-hydroxylase
  • Vitamin D(3) 25-hydroxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(54 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
CYP7A1 Antibody
(946902) [Unconjugate
MAB9120
Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
CYP24A1 Antibody
NBP1-85495
Immunohistochemistry-Paraffin CYP24A1 Antibody
Immunohistochemistry-Paraffin CYP24A1 Antibody
Immunohistochemistry-Paraffin CYP24A1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Knockout Validated Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(49 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Recombinant Human
CYP27B1 GST (N-Term) ...
H00001594-Q01
Other Recombinant Human CYP27B1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Recombinant Human
PTRH1 GST (N-Term) Pr ...
H00138428-P01
Other Recombinant Human PTRH1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB

Osteoprotegerin/TNFRSF
DY805
N/A Osteoprotegerin/TNFRSF11B [Biotin]
(87 Publications)
Species: Hu
Applications: ELISA
CYP2R1 Antibody
NBP1-32883
Immunohistochemistry-Paraffin CYP2R1 Antibody
Immunocytochemistry/ Immunofluorescence CYP2R1 Antibody
Immunohistochemistry-Paraffin CYP2R1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
Cytochrome P450
3A4 Antibody (3H8) - ...
NBP2-37502
ELISA Cytochrome P450 3A4 Antibody (3H8) - BSA Free
Western Blot Cytochrome P450 3A4 Antibody (3H8) - BSA Free
Western Blot Cytochrome P450 3A4 Antibody (3H8) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
VDR/NR1I1/Vitamin
D Receptor Antibody ( ...
NBP2-66778
Flow Cytometry VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)
Immunohistochemistry-Paraffin VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)
Immunohistochemistry-Paraffin VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
CYP7B1 Antibody
(M17-P3F2) - BSA Free
NBP2-50217
Western Blot CYP7B1 Antibody (M17-P3F2) - BSA Free
Immunohistochemistry-Paraffin CYP7B1 Antibody (M17-P3F2) - BSA Free
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
ASRGL1 Antibody
NBP1-89133
Immunocytochemistry/ Immunofluorescence ASRGL1 Antibody
Immunohistochemistry-Paraffin ASRGL1 Antibody
Immunohistochemistry-Paraffin ASRGL1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Alkaline
Phosphatase/ALPP Anti ...
NB110-3638
Immunocytochemistry/ Immunofluorescence Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
Immunohistochemistry-Paraffin Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
Western Blot Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
ATRNL1 Antibody
NBP1-89131
Immunohistochemistry ATRNL1 Antibody
Immunocytochemistry/ Immunofluorescence ATRNL1 Antibody
Immunohistochemistry-Paraffin ATRNL1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CCL27/CTACK [HRP]
DCC270
N/A CCL27/CTACK [HRP]
N/A CCL27/CTACK [HRP]
(10 Publications)
Species: Hu
Applications: ELISA
CYP27A1
Recombinant Protein A
NBP2-32433PEP
CYP27A1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CYP27A1 Protein (NBP2-32433PEP) (0)

There are no publications for CYP27A1 Protein (NBP2-32433PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP27A1 Protein (NBP2-32433PEP) (0)

There are no reviews for CYP27A1 Protein (NBP2-32433PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CYP27A1 Protein (NBP2-32433PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP27A1 Products

Research Areas for CYP27A1 Protein (NBP2-32433PEP)

Find related products by research area.

Blogs on CYP27A1

There are no specific blogs for CYP27A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CYP27A1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CYP27A1