Home » CYP24A1 » CYP24A1 Proteins » CYP24A1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CYP24A1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CYP24A1 Recombinant Protein Antigen (NBP2-57213PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CYP24A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP24A1.

Source: E. coli

Amino Acid Sequence: KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP24A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57213.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CYP24A1 Recombinant Protein Antigen

  • 24-OHase
  • 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  • CP241
  • CYP24
  • CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase
  • CYP24A1
  • Cytochrome P450 24A1
  • cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase
  • cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)
  • Cytochrome P450-CC24
  • EC 1.14.13.n4
  • EC 1.14.15.16
  • exo-mitochondrial protein
  • MGC126273
  • MGC126274
  • P450-CC24
  • vitamin D 24-hydroxylase
  • Vitamin D(3) 24-hydroxylase

Background

The immunosuppressant cyclosporin A (CsA) forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. Cyclophilins are conserved, ubiquitous and abundant cytosolic peptidyl-prolyl cis-trans isomerases that accelerate the isomerization of XaaPro peptide bonds and the refolding of proteins. Human cyclophilin A (CyPA), an intracellular protein of 165 amino acids, is the target of the CsA and is encoded by a single unique gene conserved from yeast to humans. CyPA is involved in T cell differentiation and proliferation and is highly expressed in brain. CyPA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
CYP27B1 GST (N-Term) ...
H00001594-Q01
Other Recombinant Human CYP27B1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
VDR/NR1I1/Vitamin
D Receptor Antibody ( ...
NBP2-66778
Flow Cytometry VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)
Immunohistochemistry-Paraffin VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)
Immunohistochemistry-Paraffin VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
CYP27A1 Antibody
NBP2-32433
Immunohistochemistry-Paraffin CYP27A1 Antibody
Immunohistochemistry-Paraffin CYP27A1 Antibody
Immunohistochemistry-Paraffin CYP27A1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
CYP2R1 Antibody
NBP1-32883
Immunohistochemistry-Paraffin CYP2R1 Antibody
Immunocytochemistry/ Immunofluorescence CYP2R1 Antibody
Immunohistochemistry-Paraffin CYP2R1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Osteopontin/OPN
Antibody [Unconjugate
AF808
Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]
Neutralization Osteopontin/OPN Antibody [Unconjugated]
Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]
(2 Reviews)
(208 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(56 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Vitamin D BP
Antibody
NBP1-88027
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
(2 Reviews)
(1 Publication)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
PTRH1 Antibody
NBP1-86713
Immunohistochemistry-Paraffin PTRH1 Antibody
Species: Hu
Applications: IHC, IHC-P
CYP26A1 Antibody
(1E1D2)
NBP3-16627
Immunohistochemistry-Paraffin CYP26A1 Antibody (1E1D2)
Immunocytochemistry/ Immunofluorescence CYP26A1 Antibody (1E1D2)
Immunocytochemistry/ Immunofluorescence CYP26A1 Antibody (1E1D2)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
FGF-23 Antibody
(283507) [Unconjugate
MAB26291
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Western Blot FGF-23 Antibody (283507) [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC
TRPV6 Antibody
NBP3-33063
Western Blot TRPV6 Antibody
Immunohistochemistry TRPV6 Antibody
Immunocytochemistry/ Immunofluorescence TRPV6 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cytochrome P450
3A4 Antibody (3H8) - ...
NBP2-37502
ELISA Cytochrome P450 3A4 Antibody (3H8) - BSA Free
Western Blot Cytochrome P450 3A4 Antibody (3H8) - BSA Free
Western Blot Cytochrome P450 3A4 Antibody (3H8) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunohistochemistry HSD17B4 Antibody (OTI4C4)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
CYP24A1
Recombinant Protein A
NBP2-57213PEP
CYP24A1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CYP24A1 Recombinant Protein Antigen (NBP2-57213PEP) (0)

There are no publications for CYP24A1 Recombinant Protein Antigen (NBP2-57213PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP24A1 Recombinant Protein Antigen (NBP2-57213PEP) (0)

There are no reviews for CYP24A1 Recombinant Protein Antigen (NBP2-57213PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CYP24A1 Recombinant Protein Antigen (NBP2-57213PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP24A1 Products

Blogs on CYP24A1

There are no specific blogs for CYP24A1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CYP24A1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CYP24A1