Novus Biologicals products are now on bio-techne.com

Recombinant Human CYP24A1 GST (N-Term) Protein

Name: Recombinant Human CYP24A1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001591-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

SDS-Page: Recombinant Human CYP24A1 Protein [H00001591-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human CYP24A1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 415-514 of Human CYP24A1 Source: Wheat Germ (in vitro) Amino Acid Sequence: LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	CYP24A1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array SDS-Page Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP24A1 GST (N-Term) Protein

24-OHase
25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
CP241
CYP24
CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase
CYP24A1
Cytochrome P450 24A1
cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase
cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)
Cytochrome P450-CC24
EC 1.14.13.n4
EC 1.14.15.16
exo-mitochondrial protein
MGC126273
MGC126274
P450-CC24
vitamin D 24-hydroxylase
Vitamin D(3) 24-hydroxylase

Background

CYP24A1 - cytochrome P450, family 24, subfamily A, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
CYP27B1 GST (N-Term) ...

H00001594-Q01

Species: Hu

Applications: ELISA, AP, PA, WB

VDR/NR1I1/Vitamin
D Receptor Antibody ( ...

NBP2-66778

Immunohistochemistry-Paraffin VDR/NR1I1/Vitamin D Receptor Antibody (JA11-16)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

CYP27A1 Antibody

NBP2-32433

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

PTH Antibody
(918462) [Unconjugate

MAB7665

Western Blot PTH Antibody (918462) [Unconjugated]

Species: Hu

Applications: IHC, WB

CYP2R1 Antibody

NBP1-32883

Immunocytochemistry/ Immunofluorescence CYP2R1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P

Osteopontin/OPN
Antibody [Unconjugate

AF808

Neutralization Osteopontin/OPN Antibody [Unconjugated]

Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]

(2 Reviews)

(207 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Osteocalcin
Antibody (190125)

MAB1419

Immunocytochemistry Osteocalcin Antibody (190125)

(3 Reviews)

(56 Publications)

Species: Hu, Rt

Applications: CyTOF-ready, ICC, IHC, ICFlow

Vitamin D BP
Antibody

NBP1-88027

(2 Reviews)

(1 Publication)

Species: Eq, Hu, Mu, Rt

Applications: IHC, IHC-P, Simple Western, WB

PTRH1 Antibody

NBP1-86713

Species: Hu

Applications: IHC, IHC-P

CYP26A1 Antibody
(1E1D2)

NBP3-16627

Immunocytochemistry/ Immunofluorescence CYP26A1 Antibody (1E1D2)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PXR/NR1I2 Antibody
(H4417) [Unconjugated ...

PP-H4417-00

(2 Publications)

Species: Hu

Applications: DirELISA, IP, WB

FGF-23 Antibody
(283507) [Unconjugate

MAB26291

Western Blot FGF-23 Antibody (283507) [Unconjugated]

(22 Publications)

Species: Mu

Applications: IHC

TRPV6 Antibody

NBP3-33063

Immunocytochemistry/ Immunofluorescence TRPV6 Antibody

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Cytochrome P450
3A4 Antibody (3H8) - ...

NBP2-37502

Western Blot Cytochrome P450 3A4 Antibody (3H8) - BSA Free

(1 Publication)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

HSD17B4 Antibody
(OTI4C4)

NBP2-46005

Immunohistochemistry HSD17B4 Antibody (OTI4C4)

(1 Review)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB

Recombinant Human
CYP24A1 GST (N-Term) ...

H00001591-Q01

Species: Hu

Applications: WB, ELISA, MA, PAGE, AP

Publications for CYP24A1 Partial Recombinant Protein (H00001591-Q01) (0)

There are no publications for CYP24A1 Partial Recombinant Protein (H00001591-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP24A1 Partial Recombinant Protein (H00001591-Q01) (0)

There are no reviews for CYP24A1 Partial Recombinant Protein (H00001591-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP24A1 Partial Recombinant Protein (H00001591-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP24A1 Products

Blogs on CYP24A1

There are no specific blogs for CYP24A1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteopontin/OPN Antibody [Unconjugated]
AF808

Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Osteocalcin Antibody (190125)
MAB1419

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human CYP24A1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

CYP24A1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human CYP24A1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human CYP24A1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human CYP24A1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CYP24A1 Partial Recombinant Protein (H00001591-Q01) (0)

Reviews for CYP24A1 Partial Recombinant Protein (H00001591-Q01) (0)

Product General Protocols

Video Protocols

FAQs for CYP24A1 Partial Recombinant Protein (H00001591-Q01) (0)

Additional CYP24A1 Products

Blogs on CYP24A1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics