![Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Analysis in human liver and kidney tissues using NBP1-86019 antibody. Corresponding CPS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86019-img0011.jpg "Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Analysis in human liver and kidney tissues using NBP1-86019 antibody. Corresponding CPS1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Ca, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA |
| Predicted Species | Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP1-86019 | Applications | Species |
|---|---|---|
| van Straten G, van Steenbeek FG, Grinwis GC et al. Aberrant Expression and Distribution of Enzymes of the Urea Cycle and Other Ammonia Metabolizing Pathways in Dogs with Congenital Portosystemic Shunts. PLoS One 2014-01-01 [PMID: 24945279] (IF/IHC, Canine) | IF/IHC | Canine |
Secondary Antibodies |
Isotype Controls |
Research Areas for CPS1 Antibody (NBP1-86019)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPS1 |
![Western Blot: CPS1 Antibody [NBP1-86019] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/CPS1-Antibody-Western-Blot-NBP1-86019-img0005.jpg "Western Blot: CPS1 Antibody [NBP1-86019] - Analysis in human liver tissue.")
![Immunocytochemistry/Immunofluorescence: CPS1 Antibody [NBP1-86019] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CPS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86019-img0006.jpg "Immunocytochemistry/Immunofluorescence: CPS1 Antibody [NBP1-86019] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/CPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86019-img0014.jpg "Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/CPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86019-img0012.jpg "Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86019-img0013.jpg "Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/CPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86019-img0015.jpg "Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Chromatin_Immunoprecipitation_11227.jpg)
![Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Immunocytochemistry_6484.jpg)
![Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF3_beta_AF2400_Immunohistochemistry_23167.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")