Home » COPS8 » COPS8 Proteins » COPS8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

COPS8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for COPS8 Protein (NBP1-84407PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

COPS8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COPS8.

Source: E. coli

Amino Acid Sequence: VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COPS8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84407.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COPS8 Recombinant Protein Antigen

  • COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
  • COP9 homolog
  • COP9 signalosome complex subunit 8
  • COP9
  • CSN8JAB1-containing signalosome subunit 8
  • hCOP9
  • MGC1297
  • MMMEP
  • SGN8MGC43256
  • Signalosome subunit 8

Background

COPS8 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

JAB1 Antibody
(2A10.8)
NB120-495
Western Blot JAB1 Antibody (2A10.8)
Immunohistochemistry JAB1 Antibody (2A10.8)
Western Blot JAB1 Antibody (2A10.8)
(11 Publications)
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NEDD8
[Unconjugated]
UL-812
NEDD8 [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: EnzAct
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Recombinant Human
CAC1 GST (N-Term) Pro ...
H00143384-P01
SDS-PAGE Recombinant Human CAC1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9)
(6 Publications)
Species: Hu
Applications: ELISA, WB
Cullin 1 Antibody
- Azide and BSA Free
NBP3-16092
Western Blot Cullin 1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Cullin 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Cullin 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
CSN1 Antibody -
BSA Free
NBP2-92907
Immunohistochemistry-Paraffin CSN1 Antibody - BSA Free
Immunohistochemistry-Paraffin CSN1 Antibody - BSA Free
Western Blot CSN1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COP9 signalosome
complex subunit 2 Ant ...
NBP2-15958
Immunocytochemistry/ Immunofluorescence COP9 signalosome complex subunit 2 Antibody
Immunohistochemistry-Paraffin COP9 signalosome complex subunit 2 Antibody
Immunohistochemistry-Paraffin COP9 signalosome complex subunit 2 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(202 Publications)
Species: Hu
Applications: BA
COP9 Antibody
NBP1-85435
Immunohistochemistry-Paraffin COP9 Antibody
Western Blot COP9 Antibody
Western Blot COP9 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Casein Antibody
NBP2-55090
Immunohistochemistry-Paraffin Casein Antibody
Immunohistochemistry-Paraffin Casein Antibody
Immunohistochemistry-Paraffin Casein Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
IL-31RA Antibody
[Unconjugated]
AF2769
Flow Cytometry IL-31RA Antibody [Unconjugated]
Immunocytochemistry IL-31RA Antibody [Unconjugated]
Immunocytochemistry IL-31RA Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
COP Antibody
NB100-856
Immunocytochemistry/ Immunofluorescence COP Antibody
Flow Cytometry COP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
beta Casein
Antibody
NBP1-88188
Immunohistochemistry-Paraffin beta Casein Antibody
Immunohistochemistry-Paraffin beta Casein Antibody
Immunohistochemistry-Paraffin beta Casein Antibody
Species: Hu
Applications: IHC, IHC-P
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA

Publications for COPS8 Protein (NBP1-84407PEP) (0)

There are no publications for COPS8 Protein (NBP1-84407PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPS8 Protein (NBP1-84407PEP) (0)

There are no reviews for COPS8 Protein (NBP1-84407PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COPS8 Protein (NBP1-84407PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COPS8 Products

Research Areas for COPS8 Protein (NBP1-84407PEP)

Find related products by research area.

Blogs on COPS8

There are no specific blogs for COPS8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COPS8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol COPS8