Novus Biologicals products are now on bio-techne.com

Recombinant Human CLECL1 GST (N-Term) Protein

Name: Recombinant Human CLECL1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00160365-Q01
Price: 489 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human CLECL1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 82-167 of Human CLECL1 Source: Wheat Germ (in vitro) Amino Acid Sequence: DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	CLECL1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	35.2 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLECL1 GST (N-Term) Protein

CLECL1
C-type lectin-like 1
C-type lectin-like domain family 1
DCAL1
DCAL-1
DCAL1dendritic cell associated lectin 1
DC-Associated Lectin-1
Dendritic Cell-Associated Lectin 1
dendritic cell-associated lectin-1
type II transmembrane protein DCAL1

Background

DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AHCYL1 Antibody

NBP1-83093

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

SLC4A4 Antibody

NBP2-32020

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

IP3R1 Antibody

NBP1-21398

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

IL-4 [Unconjugated]

6507-IL/CF

(3 Publications)

Species: Hu

Applications: BA

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

IP3R3 Antibody

NBP1-21399

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, IP, WB (-)

Adenosylhomocysteinase

NBP2-48817

Immunohistochemistry-Paraffin Adenosylhomocysteinase/AHCY Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CFTR Antibody
(24-1) [Unconjugated] ...

MAB25031

Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus

(10 Reviews)

(75 Publications)

Species: Hu

Applications: IHC, IP, WB

DC-SIGN/CD209
Antibody (120507) [Un ...

MAB161

(1 Review)

(46 Publications)

Species: Hu

Applications: AdBlk, CyTOF-ready, Flow, WB

PSMC6 Antibody
(2C4)

H00005706-M02

Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, KD, WB

Doublecortin
Antibody

NBP1-72042

Immunocytochemistry/ Immunofluorescence Doublecortin Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Recombinant Human
IFI44 GST (N-Term) Pr ...

H00010561-P01

Species: Hu

Applications: ELISA, AP, PA, WB

CD3 Antibody (SP7)

NB600-1441

Immunohistochemistry-Paraffin CD3 Antibody (SP7)

(3 Reviews)

(44 Publications)

Species: Ca, Hu, Mu, Po

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD

p38 gamma/SAPK3
Antibody [Unconjugate

AF1347

Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]

Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]

(8 Publications)

Species: Hu, Mu, Rt

Applications: ICC, IHC, Simple Western, WB

CD4 Antibody - BSA
Free

NBP1-19371

Immunohistochemistry-Paraffin CD4 Antibody - BSA Free

(9 Reviews)

(50 Publications)

Species: Ca, Hu, Mu, Po, Rb, Rt

Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

SGSM3 Antibody

NBP2-13304

Immunocytochemistry/ Immunofluorescence SGSM3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

JNK1 Antibody
(228601) [Unconjugate

MAB17761

Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

GTF2H2 Antibody
(PCRP-GTF2H2-1B9)

NBP3-07348

Flow Cytometry GTF2H2 Antibody (PCRP-GTF2H2-1B9)

Immunocytochemistry/ Immunofluorescence GTF2H2 Antibody (PCRP-GTF2H2-1B9)

Species: Hu

Applications: Flow, ICC/IF, PA

IFN-gamma
[Unconjugated]

285-IF

(2 Reviews)

(445 Publications)

Species: Hu

Applications: BA

Publications for CLECL1 Partial Recombinant Protein (H00160365-Q01) (0)

There are no publications for CLECL1 Partial Recombinant Protein (H00160365-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLECL1 Partial Recombinant Protein (H00160365-Q01) (0)

There are no reviews for CLECL1 Partial Recombinant Protein (H00160365-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLECL1 Partial Recombinant Protein (H00160365-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLECL1 Products

Blogs on CLECL1

There are no specific blogs for CLECL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .

IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

PDF Datasheet

Request CofA

Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human CLECL1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

CLECL1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human CLECL1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human CLECL1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human CLECL1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CLECL1 Partial Recombinant Protein (H00160365-Q01) (0)

Reviews for CLECL1 Partial Recombinant Protein (H00160365-Q01) (0)

Product General Protocols

Video Protocols

FAQs for CLECL1 Partial Recombinant Protein (H00160365-Q01) (0)

Additional CLECL1 Products

Blogs on CLECL1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics