![Immunohistochemistry: CIB1 Antibody [NBP2-68646] - Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CIB1-Antibody-Immunohistochemistry-NBP2-68646-img0001.jpg "Immunohistochemistry: CIB1 Antibody [NBP2-68646] - Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CIB1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Recommended conditions for IHC,Retrieval method: HIER pH6 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CIB1 Antibody (NBP2-68646)Find related products by research area.
|
|
IRE1 alpha dependent apoptotic-signaling pathway Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CIB1 |
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")