Home » Chondroitin sulfate synthase 3 » Chondroitin sulfate synthase 3 Proteins » Chondroitin sulfate synthase 3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Chondroitin sulfate synthase 3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Chondroitin sulfate synthase 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHSY3.

Source: E. coli

Amino Acid Sequence: LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHSY3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85626.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Chondroitin sulfate synthase 3 Recombinant Protein Antigen

  • Carbohydrate synthase 2
  • Chondroitin glucuronyltransferase 3
  • chondroitin sulfate synthase 3
  • Chondroitin synthase 2
  • chondroitin synthase-2
  • CHSY2
  • chSy-2
  • CSS3N-acetylgalactosaminyltransferase 3
  • EC 2.4.1.175
  • EC 2.4.1.226
  • Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase II
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3

Background

Chondroitin sulfate synthases (CHSYs) synthesize chondroitin sulfate, a glycosaminoglycan expressed on the surface of most cells and in extracellular matrices. Glycosaminoglycan chains are covalently linked to various of core protein families and regulate many biologic processes, including extracellular matrix deposition, cell proliferation and recognition, and morphogenesis. The CHSY family includes CHSY1, CHSY2 and CHSY3. CHSY1 and CHSY3 display both glucuronyltransferase and N-acetylgalactosaminyltransferase activities, while CHSY2 is required for chondroitin polymerizing activity. CHSY2 localizes to the Golgi apparatus and is expressed ubiquitously, with highest expression observed in pancreas, ovary, brain, heart, skeletal muscle, colon, kidney, liver, stomach, small intestine and placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CSGLCAT Antibody
NBP1-88086
Immunocytochemistry/ Immunofluorescence CSGLCAT Antibody
Immunohistochemistry-Paraffin CSGLCAT Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
CHSY1 Antibody
NBP2-13838
Immunohistochemistry-Paraffin CHSY1 Antibody
Species: Hu
Applications: IHC, IHC-P
FGF-23 Antibody
(283507) [Unconjugate
MAB26291
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Western Blot FGF-23 Antibody (283507) [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC
CHSS2 Antibody
NBP1-88087
Western Blot CHSS2 Antibody
Immunocytochemistry/ Immunofluorescence CHSS2 Antibody
Immunohistochemistry-Paraffin CHSS2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SNAP25 Interacting
Protein Antibody
NBP1-03414
Immunocytochemistry/ Immunofluorescence SNAP25 Interacting Protein Antibody
Immunocytochemistry/ Immunofluorescence SNAP25 Interacting Protein Antibody
(2 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Neuregulin-1/NRG1
Antibody (147724) [Un ...
MAB377
Neuregulin-1/NRG1 Antibody (147724) [Unconjugated]
(84 Publications)
Species: Hu
Applications: WB
Polypeptide GalNac
Transferase 3/GALNT3 ...
AF7174
Western Blot Polypeptide GalNac Transferase 3/GALNT3 Antibody
Immunocytochemistry Polypeptide GalNac Transferase 3/GALNT3 Antibody
(3 Publications)
Species: Hu
Applications: ICC, WB
Amisyn Antibody
NB100-1227
Immunohistochemistry Amisyn Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Calpain S1
Antibody (3C4)
H00000826-M01
Western Blot Calpain S1 Antibody (3C4)
Immunocytochemistry/ Immunofluorescence Calpain S1 Antibody (3C4)
Immunohistochemistry-Paraffin Calpain S1 Antibody (3C4)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
Recombinant Human
TMPRSS13 GST (N-Term) ...
H00084000-Q01
SDS-PAGE Recombinant Human TMPRSS13 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MSP/MST1
[Unconjugated]
352-MS
MSP/MST1 [Unconjugated]
(9 Publications)
Species: Hu
Applications: BA, BA
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Invadolysin
Antibody
NBP1-92025
Western Blot Invadolysin Antibody
Western Blot Invadolysin Antibody
Immunohistochemistry-Paraffin Invadolysin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CHST11 Antibody
(4F1)
H00050515-M01
Sandwich ELISA CHST11 Antibody (4F1)
Western Blot CHST11 Antibody (4F1)
Western Blot CHST11 Antibody (4F1)
Species: Hu
Applications: ELISA, S-ELISA, WB
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Western Blot HIF-2 alpha/EPAS1 Antibody - BSA Free
(37 Reviews)
(822 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
APCDD1 Antibody -
BSA Free
NB110-92756
Western Blot APCDD1 Antibody - BSA Free
Knockdown Validated APCDD1 Antibody - BSA Free
(2 Publications)
Species: Ch, Hu, Mu, Re
Applications: KD, WB
OSR2 Antibody
NBP2-56333
Western Blot OSR2 Antibody
Immunocytochemistry/ Immunofluorescence OSR2 Antibody
Species: Hu
Applications: ICC/IF, WB

Publications for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP) (0)

There are no publications for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP) (0)

There are no reviews for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chondroitin sulfate synthase 3 Products

Blogs on Chondroitin sulfate synthase 3

There are no specific blogs for Chondroitin sulfate synthase 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
HIF-2 alpha/EPAS1 Antibody - BSA Free
NB100-122

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Chondroitin sulfate synthase 3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CHSY3