Novus Biologicals products are now on bio-techne.com

CENPB Recombinant Protein Antigen

Images

 
There are currently no images for CENPB Recombinant Protein Antigen (NBP2-55433PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

CENPB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CENPB.

Source: E. coli

Amino Acid Sequence: ERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CENPB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55433.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CENPB Recombinant Protein Antigen

  • CENP-B
  • centromere autoantigen B
  • centromere protein B (80kD)
  • Centromere protein B
  • centromere protein B, 80kDa
  • major centromere autoantigen B

Background

CENPB product is a highly conserved protein associated with the centromere. It is a DNA-binding protein containing a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. The DNA binding domain recognizes and binds a 17-bp sequence (CENP-B box) in the centromeric satellite DNA. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13389
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00378708-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-33548
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-91988
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NBP3-24732
Species: Hu
Applications: ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP1-82546
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB

Publications for CENPB Recombinant Protein Antigen (NBP2-55433PEP) (0)

There are no publications for CENPB Recombinant Protein Antigen (NBP2-55433PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPB Recombinant Protein Antigen (NBP2-55433PEP) (0)

There are no reviews for CENPB Recombinant Protein Antigen (NBP2-55433PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CENPB Recombinant Protein Antigen (NBP2-55433PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CENPB Products

Research Areas for CENPB Recombinant Protein Antigen (NBP2-55433PEP)

Find related products by research area.

Blogs on CENPB

There are no specific blogs for CENPB, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CENPB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPB