Novus Biologicals products are now on bio-techne.com

CDKL5 Recombinant Protein Antigen

Name: CDKL5 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84881PEP
Price: 279 USD

Images

There are currently no images for CDKL5 Protein (NBP1-84881PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CDKL5 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDKL5. Source: E. coli Amino Acid Sequence: AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CDKL5
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84881. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDKL5 Recombinant Protein Antigen

CDKL5
cyclin-dependent kinase-like 5
serine/threonine kinase 9
serine/threonine-protein kinase 9
STK9

Background

CDKL5 - cyclin-dependent kinase-like 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MeCP2 Antibody

NB100-56326

Immunocytochemistry/ Immunofluorescence MeCP2 Antibody

Immunohistochemistry-Paraffin MeCP2 Antibody

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

ARX Antibody

AF7068

(11 Publications)

Species: Hu

Applications: ICC, IHC, WB

SAE2 Antibody
(OTI4A3)

NBP2-03688

Immunohistochemistry-Paraffin SAE2 Antibody (OTI4A3)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

FOXG1 Antibody -
BSA Free

NBP2-81942

Immunocytochemistry/ Immunofluorescence FOXG1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

Syntaxin-BP1
Antibody [Unconjugate

AF5675

Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]

Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]

Species: Hu, Mu, Rt

Applications: IHC, IP, KO, WB

Protocadherin-19
Antibody (921614) [Un ...

MAB8626

Species: Hu

Applications: CyTOF-ready, Flow

BDNF [HRP]

DBD00

(104 Publications)

Species: Hu

Applications: ELISA

Netrin-G1a
Antibody [Unconjugate

AF1166

Immunocytochemistry/ Immunofluorescence Netrin-G1a Antibody [Unconjugated]

(7 Publications)

Species: Mu

Applications: WB

DNMT1 Antibody
(60B1220.1) - BSA Fre

NB100-56519

Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free

(4 Reviews)

(144 Publications)

Species: Bv, Hu, Mu, Po, Rt, Sh

Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

Netrin-G2a
Antibody (349724)

MAB27441

Species: Mu

Applications: IHC, WB

Protocadherin-10
[Unconjugated]

6510-CA

Species: Hu

Applications: BA

E6AP/UBE3A
Antibody (2F6)

H00007337-M01

(4 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB

MBD5 Antibody
(4A12-1B6)

H00055777-M01

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, S-ELISA, WB

NHS Antibody (6D9)

H00004810-M05

Immunocytochemistry/ Immunofluorescence NHS Antibody (6D9)

Species: Hu

Applications: ELISA, ICC/IF, WB

OCA2 Antibody -
BSA Free

NBP2-93603

Species: Hu, Mu

Applications: WB

SLC25A22 Antibody

NBP1-84880

Immunohistochemistry-Paraffin SLC25A22 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

PNK Antibody

NBP1-87257

(9 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB

SGSM3 Antibody

NBP2-13304

Immunocytochemistry/ Immunofluorescence SGSM3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Publications for CDKL5 Protein (NBP1-84881PEP) (0)

There are no publications for CDKL5 Protein (NBP1-84881PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL5 Protein (NBP1-84881PEP) (0)

There are no reviews for CDKL5 Protein (NBP1-84881PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDKL5 Protein (NBP1-84881PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDKL5 Products

Research Areas for CDKL5 Protein (NBP1-84881PEP)

Find related products by research area.

Protein Kinase

Blogs on CDKL5

There are no specific blogs for CDKL5, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0

DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our CDKL5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CDKL5

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

CDKL5 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

CDKL5 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CDKL5 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CDKL5 Protein (NBP1-84881PEP) (0)

Reviews for CDKL5 Protein (NBP1-84881PEP) (0)

FAQs for CDKL5 Protein (NBP1-84881PEP) (0)

Additional CDKL5 Products

Research Areas for CDKL5 Protein (NBP1-84881PEP)

Blogs on CDKL5

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics