Home » CDC40 » CDC40 Proteins » CDC40 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CDC40 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CDC40 Recombinant Protein Antigen (NBP2-58541PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CDC40 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC40.

Source: E. coli

Amino Acid Sequence: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC40
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58541.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC40 Recombinant Protein Antigen

  • cell division cycle 40 homolog (S. cerevisiae)
  • cell division cycle 40 homolog (yeast)
  • Cell division cycle 40 homolog
  • Ehb3
  • EH-binding protein 3
  • hPRP17
  • MGC102802
  • pre-mRNA splicing factor 17
  • pre-mRNA-processing factor 17
  • PRP17 homolog
  • PRP17EHB3PRPF17FLJ10564

Background

Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DHX38 Antibody
NBP1-85269
Western Blot DHX38 Antibody
Western Blot DHX38 Antibody
Immunohistochemistry-Paraffin DHX38 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PRP18 Antibody
NBP1-92297
Western Blot PRP18 Antibody
Immunohistochemistry-Paraffin PRP18 Antibody
Western Blot PRP18 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DHX16 Antibody
NBP2-13920
Immunocytochemistry/ Immunofluorescence DHX16 Antibody
Immunohistochemistry-Paraffin DHX16 Antibody
Immunohistochemistry-Paraffin DHX16 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DHX8 Antibody
NBP2-13923
Western Blot DHX8 Antibody
Immunohistochemistry-Paraffin DHX8 Antibody
Immunohistochemistry-Paraffin DHX8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
SLU7 Antibody
NBP2-20403
Western Blot SLU7 Antibody
Western Blot SLU7 Antibody
Immunohistochemistry-Paraffin SLU7 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PRPF8 Antibody -
BSA Free
NBP2-93689
Immunocytochemistry/ Immunofluorescence PRPF8 Antibody - BSA Free
Western Blot PRPF8 Antibody - BSA Free
Immunohistochemistry-Paraffin PRPF8 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CDC5L Antibody
NBP1-85720
Immunohistochemistry-Paraffin CDC5L Antibody
Immunocytochemistry/ Immunofluorescence CDC5L Antibody
Immunohistochemistry-Paraffin CDC5L Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ATP7b Antibody -
BSA Free
NB100-360
Immunocytochemistry/ Immunofluorescence ATP7b Antibody - BSA Free
Western Blot ATP7b Antibody - BSA Free
Immunohistochemistry ATP7b Antibody - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
PRP19 Antibody
(4M3Z1)
NBP3-16853
Immunohistochemistry-Paraffin PRP19 Antibody (4M3Z1)
Immunohistochemistry-Paraffin PRP19 Antibody (4M3Z1)
Immunohistochemistry-Paraffin PRP19 Antibody (4M3Z1)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Band 3 Antibody
NBP2-49409
Immunohistochemistry Band 3 Antibody
Immunohistochemistry-Paraffin Band 3 Antibody
Immunohistochemistry-Paraffin Band 3 Antibody
Species: Hu
Applications: IHC, IHC-P
Nurr1/NGFI-B
beta/NR4A2 Antibody [ ...
AF2156
Immunocytochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]
Immunohistochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]
(19 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
BUD31 Antibody
NBP1-84010
Western Blot BUD31 Antibody
Immunohistochemistry-Paraffin BUD31 Antibody
Immunocytochemistry/ Immunofluorescence BUD31 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SYF2 Antibody
(OTI6A5)
NBP2-46033
Immunohistochemistry SYF2 Antibody (OTI6A5)
Immunohistochemistry SYF2 Antibody (OTI6A5)
Immunohistochemistry SYF2 Antibody (OTI6A5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Tripeptidyl-Peptidase
NBP2-48820
Immunohistochemistry Tripeptidyl-Peptidase I/TPP1 Antibody
Immunohistochemistry Tripeptidyl-Peptidase I/TPP1 Antibody
Immunohistochemistry-Paraffin Tripeptidyl-Peptidase I/TPP1 Antibody
Species: Hu
Applications: IHC, IHC-P
XAB2 Antibody
(1D1-1A9)
H00056949-M01
Immunocytochemistry/ Immunofluorescence XAB2 Antibody (1D1-1A9)
Immunohistochemistry-Paraffin XAB2 Antibody (1D1-1A9)
Western Blot XAB2 Antibody (1D1-1A9)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SNW1 Antibody
NBP1-88523
Western Blot SNW1 Antibody
Immunohistochemistry-Paraffin SNW1 Antibody
Immunohistochemistry-Paraffin SNW1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SC35 Antibody
NBP2-47290
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
Immunohistochemistry-Paraffin SC35 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ISY1 Antibody
NBP1-81865
Immunohistochemistry-Paraffin ISY1 Antibody
Immunohistochemistry-Paraffin ISY1 Antibody
Immunohistochemistry-Paraffin ISY1 Antibody
(2 Publications)
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for CDC40 Recombinant Protein Antigen (NBP2-58541PEP) (0)

There are no publications for CDC40 Recombinant Protein Antigen (NBP2-58541PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC40 Recombinant Protein Antigen (NBP2-58541PEP) (0)

There are no reviews for CDC40 Recombinant Protein Antigen (NBP2-58541PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC40 Recombinant Protein Antigen (NBP2-58541PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC40 Products

Research Areas for CDC40 Recombinant Protein Antigen (NBP2-58541PEP)

Find related products by research area.

Blogs on CDC40

There are no specific blogs for CDC40, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: ATP7b Antibody [NB100-360] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-ATP7b [NB100-360] at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at 1:500. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
ATP7b Antibody - BSA Free
NB100-360

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC40 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDC40