CCT6A Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human TCPZ. Peptide sequence: HAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGL The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CCT6A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for CCT6A Antibody
Background
The CCT6A gene encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known asthe TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight differentproteins. Unfolded poly
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Publications for CCT6A Antibody (NBP2-87159) (0)
There are no publications for CCT6A Antibody (NBP2-87159).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCT6A Antibody (NBP2-87159) (0)
There are no reviews for CCT6A Antibody (NBP2-87159).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCT6A Antibody (NBP2-87159) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCT6A Products
Research Areas for CCT6A Antibody (NBP2-87159)
Find related products by research area.
|
Blogs on CCT6A