Novus Biologicals products are now on bio-techne.com

Cathepsin D Recombinant Protein Antigen

Name: Cathepsin D Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85562PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Cathepsin D Protein (NBP1-85562PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Cathepsin D Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTSD. Source: E. coli Amino Acid Sequence: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CTSD
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85562. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cathepsin D Recombinant Protein Antigen

cathepsin D (lysosomal aspartyl protease)
Cathepsin D
CPSD
CTSD
EC 3.4.23
EC 3.4.23.5
lysosomal aspartyl peptidase
lysosomal aspartyl protease
MGC2311
neuronal 10

Background

Cathepsin D has been reported to be involved in malignant tumour progression and with prognosis of various human cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cathepsin B
Antibody [Unconjugate

AF965

Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]

(1 Review)

(50 Publications)

Species: Mu

Applications: IHC, Neut, WB

Cathepsin L
Antibody [Unconjugate

AF952

Immunohistochemistry Cathepsin L Antibody [Unconjugated]

(27 Publications)

Species: Hu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

TFF1/pS2 Antibody

NBP1-90813

(1 Review)

(4 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

Progesterone
R/NR3C3 Antibody [Unc ...

AF5415

Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]

Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]

(2 Publications)

Species: Hu

Applications: ICC, IHC, Simple Western, WB

Renin Antibody
(411507) - Propeptide

MAB4447

(6 Publications)

Species: Hu

Applications: IHC, WB

EGFR Antibody
[Unconjugated]

AF231

Immunocytochemistry EGFR Antibody [Unconjugated]

Western Blot EGFR Antibody [Unconjugated]

(30 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

beta-Glucuronidase/GUS

NBP1-87511

Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Presenilin-2
Antibody (APS 26)

NB100-74513

Species: Hu, Mu, Pm, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

ER alpha/NR3A1
Antibody (33)

NB300-560

Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)

Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)

(1 Review)

(10 Publications)

Species: Av, Bv, Ma, Hu, Mu, Pm, Rt

Applications: IF, IHC, IHC-Fr, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

ErbB2/Her2
[Unconjugated]

1129-ER

(58 Publications)

Species: Hu

Applications: BA

Serpin
A8/Angiotensinogen An ...

NBP1-30027

Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

LAMP-1/CD107a
Antibody

NB120-19294

Immunocytochemistry/ Immunofluorescence LAMP-1/CD107a Antibody

(2 Reviews)

(36 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

u-Plasminogen
Activator/Urokinase [ ...

1310-SE

(13 Publications)

Species: Hu

Applications: EnzAct

Cathepsin E
Antibody

NB400-152

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(386 Publications)

Species: Hu, Mu

Applications: ICC, IHC

Cathepsin H
Antibody [Unconjugate

AF1013

(5 Publications)

Species: Mu

Applications: IHC, IP, WB

Plasminogen
Antibody

NB600-930

(2 Reviews)

(6 Publications)

Species: Hu, Rt

Applications: ELISA, WB

Publications for Cathepsin D Protein (NBP1-85562PEP) (0)

There are no publications for Cathepsin D Protein (NBP1-85562PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin D Protein (NBP1-85562PEP) (0)

There are no reviews for Cathepsin D Protein (NBP1-85562PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cathepsin D Protein (NBP1-85562PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cathepsin D Products

Research Areas for Cathepsin D Protein (NBP1-85562PEP)

Find related products by research area.

Blogs on Cathepsin D

There are no specific blogs for Cathepsin D, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Cathepsin B was detected in perfusion fixed frozen sections of mouse thymus using 5 µg/mL Goat Anti-Mouse Cathepsin B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF965) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

Cathepsin B Antibody [Unconjugated]
AF965

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Cathepsin D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CTSD

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Cathepsin D Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Cathepsin D Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Cathepsin D Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Cathepsin D Protein (NBP1-85562PEP) (0)

Reviews for Cathepsin D Protein (NBP1-85562PEP) (0)

FAQs for Cathepsin D Protein (NBP1-85562PEP) (0)

Additional Cathepsin D Products

Research Areas for Cathepsin D Protein (NBP1-85562PEP)

Blogs on Cathepsin D

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics