Novus Biologicals products are now on bio-techne.com

AUF1 Recombinant Protein Antigen

Name: AUF1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-88915PEP
Price: 279 USD

Images

There are currently no images for AUF1 Protein (NBP1-88915PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

100% Guarantee on every product

AUF1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPD. Source: E. coli Amino Acid Sequence: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	HNRNPD
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88915. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AUF1 Recombinant Protein Antigen

AUF1A
heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa)
heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD)
heterogeneous nuclear ribonucleoprotein D0
hnRNPD0
type A

Background

hnRNP D/AUF1 binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3' untranslated regions of many protooncogenes and cytokine mRNAs. It also binds to double and single stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single stranded nonmonotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. It may be involved in translationally coupled mRNA turnover (referenced from swissprot).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

HuR/ELAVL1
Antibody (4G8)

H00001994-M02

Immunocytochemistry/ Immunofluorescence HuR/ELAVL1 Antibody (4G8)

Immunohistochemistry-Paraffin HuR/ELAVL1 Antibody (4G8)

(1 Review)

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

RPSA Antibody
(RPSA/2699) - Azide a ...

NBP2-79854

Species: Hu

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB

p63/TP73L Antibody
[Unconjugated]

AF1916

Immunocytochemistry p63/TP73L Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]

(1 Review)

(22 Publications)

Species: Hu

Applications: ICC, IHC, WB

EBNA1BP2 Antibody

NBP1-84022

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

GEF-H1 Antibody

NBP2-21577

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB

LANCL1 Antibody

NBP1-81796

Immunohistochemistry-Paraffin LANCL1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

p40 Antibody

NBP1-32956

Immunohistochemistry-Paraffin p40 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, WB

IL-9 [Unconjugated]

409-ML/CF

(11 Publications)

Species: Mu

Applications: BA

PSMD7 Antibody

NBP2-38780

Immunohistochemistry-Paraffin PSMD7 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

HNRPDL Antibody

NBP2-38806

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

hnRNP C1 + C2
Antibody (CL2593)

NBP2-36776

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(803 Publications)

Species: Hu

Applications: BA

Skp2 Antibody

NBP2-49142

Immunohistochemistry-Paraffin Skp2 Antibody

Species: Hu

Applications: IHC, IHC-P, KD, WB

Caspase-1 Antibody
(14F468) - BSA Free

NB100-56565

Western Blot Caspase-1 Antibody (14F468) - BSA Free

(69 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Nuclear Factor
Erythroid Derived 2 A ...

NBP1-82580

Species: Hu

Applications: IHC, IHC-P, Simple Western, WB

TTP Antibody
(OTI8B5)

NBP2-02105

Immunohistochemistry-Paraffin TTP Antibody (OTI8B5)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

SUG1 Antibody
(25D5)

NB100-345

(2 Reviews)

(4 Publications)

Species: Hu

Applications: ChIP, IP, KD, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

KHSRP Antibody

NBP1-18910

(1 Review)

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Publications for AUF1 Protein (NBP1-88915PEP) (0)

There are no publications for AUF1 Protein (NBP1-88915PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AUF1 Protein (NBP1-88915PEP) (0)

There are no reviews for AUF1 Protein (NBP1-88915PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AUF1 Protein (NBP1-88915PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AUF1 Products

Research Areas for AUF1 Protein (NBP1-88915PEP)

Find related products by research area.

Stem Cell Markers

Blogs on AUF1.

Check out the latest blog posts on AUF1.

Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD)
Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm. Transportin 1 is co... Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our AUF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

HNRNPD

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

AUF1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

AUF1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for AUF1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for AUF1 Protein (NBP1-88915PEP) (0)

Reviews for AUF1 Protein (NBP1-88915PEP) (0)

FAQs for AUF1 Protein (NBP1-88915PEP) (0)

Additional AUF1 Products

Research Areas for AUF1 Protein (NBP1-88915PEP)

Blogs on AUF1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics