![Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35055_rabbit-aquaporin-4-mab-5a4w4-9122024159536.jpg "Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 5A4W4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (AQP4) (NP_001641.1). Sequence: VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | AQP4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Aquaporin-4 Antibody (NBP3-35055)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AQP4 |
![Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35055_rabbit-aquaporin-4-mab-5a4w4-912202414213777.jpg "Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35055_rabbit-aquaporin-4-mab-5a4w4-91220241581273.jpg "Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Western blot analysis of various lysates, using Aquaporin-4Rabbit mAb at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-35055_rabbit-aquaporin-4-mab-5a4w4-912202414154378.jpg "Western Blot: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Western blot analysis of various lysates, using Aquaporin-4Rabbit mAb at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.")
![Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35055_rabbit-aquaporin-4-mab-5a4w4-91220241581266.jpg "Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35055_rabbit-aquaporin-4-mab-5a4w4-912202415161859.jpg "Immunohistochemistry: Aquaporin-4 Antibody (5A4W4) [NBP3-35055] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Aquaporin-4Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")