![Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Analysis in human cell lines A-549 and HEK293 using anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize/Aldo-keto-Reductase-1B10-AKR1B10-Antibody-Western-Blot-NBP1-89161-img0011.jpg "Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Analysis in human cell lines A-549 and HEK293 using anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AKR1B10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AKR1B10 |
![Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human cell line A549 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Aldo-keto-Reductase-1B10-AKR1B10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89161-img0005.jpg "Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human cell line A549 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Aldo-keto-Reductase-1B10-AKR1B10-Antibody-Immunohistochemistry-Paraffin-NBP1-89161-img0009.jpg "Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.")
![Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-28](http://images.novusbio.com/fullsize/Aldo-keto-Reductase-1B10-AKR1B10-Antibody-Western-Blot-NBP1-89161-img0004.jpg "Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-28")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Immunohistochemistry Pleiotrophin/PTN Antibody [Unconjugated]](https://images.novusbio.com/images2/Pleiotrophin_AF252PB_Immunohistochemistry_23024.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")