Home » ABCA3 » ABCA3 Proteins » ABCA3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ABCA3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ABCA3 Protein (NBP1-89310PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ABCA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA3.

Source: E. coli

Amino Acid Sequence: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89310.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA3 Recombinant Protein Antigen

  • ABC transporter 3
  • ABC3MGC72201
  • ABC-C transporter
  • ABC-C
  • ATP-binding cassette 3
  • ATP-binding cassette sub-family A member 3
  • ATP-binding cassette transporter 3
  • ATP-binding cassette, sub-family A (ABC1), member 3
  • EC 3.6.3
  • EC 3.6.3.17
  • EST111653
  • LBM180
  • MGC166979
  • SMDP3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC)transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes aredivided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of theABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellulareukaryotes. The full transporter encoded by this gene may be involved in development of resistance to xenobiotics andengulfment during programmed cell death. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prosurfactant
Protein C Antibody
NBP1-87201
Western Blot Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
SP-B/Surfactant Prote ...
H00006439-P01
Unknown Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein
(2 Publications)
Species: Hu
Applications: ELISA, AP, PA, WB
ABCB6 Antibody
NBP1-91642
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunocytochemistry/ Immunofluorescence ABCB6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TCIRG1 Antibody
(6H3)
H00010312-M01
Western Blot TCIRG1 Antibody (6H3)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
ABCA1 Antibody -
BSA Free
NB400-105
Dual RNAscope ISH-IHC ABCA1 Antibody - BSA Free
Immunohistochemistry-Paraffin ABCA1 Antibody - BSA Free
Western Blot ABCA1 Antibody - BSA Free
(7 Reviews)
(408 Publications)
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
ABCA4 Antibody
(3F4)
NBP1-30032
Knockout Validated ABCA4 Antibody (3F4)
Immunohistochemistry ABCA4 Antibody (3F4)
Knockout Validated ABCA4 Antibody (3F4)
(1 Review)
(5 Publications)
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
ABCA2 Antibody
NBP1-20863
Immunohistochemistry-Paraffin ABCA2 Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
RNA polymerase I
termination factor An ...
NBP3-27122
Immunohistochemistry RNA polymerase I termination factor Antibody (2F4D8)
Western Blot RNA polymerase I termination factor Antibody (2F4D8)
ELISA RNA polymerase I termination factor Antibody (2F4D8)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ABCA12 Antibody
NB100-93466
ABCA12 Antibody
(4 Publications)
Species: Ca, Hu, Mu
Applications: IB, ICC/IF, IP, PEP-ELISA
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(98 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Frozen MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FMRP Antibody
(OTI1C6)
NBP2-01770
Flow Cytometry FMRP Antibody (OTI1C6)
Western Blot FMRP Antibody (OTI1C6)
Immunohistochemistry-Paraffin FMRP Antibody (OTI1C6)
(1 Review)
(2 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DC-LAMP Antibody
(1010E1.01)
DDX0191P-100
Immunohistochemistry DC-LAMP Antibody (1010E1.01)
Immunohistochemistry DC-LAMP Antibody (1010E1.01)
Immunohistochemistry-Paraffin DC-LAMP Antibody (1010E1.01)
(1 Review)
(53 Publications)
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P
ABCA7 Antibody
(7A1-144)
NB400-163
Western Blot ABCA7 Antibody (7A1-144)
Flow Cytometry ABCA7 Antibody (7A1-144)
Western Blot ABCA7 Antibody (7A1-144)
Species: Mu
Applications: Flow, IHC, IHC-P, WB
ABC2 Antibody
NBP1-56876
Western Blot ABC2 Antibody
Western Blot ABC2 Antibody
Western Blot ABC2 Antibody
Species: Hu
Applications: WB

Publications for ABCA3 Protein (NBP1-89310PEP) (0)

There are no publications for ABCA3 Protein (NBP1-89310PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA3 Protein (NBP1-89310PEP) (0)

There are no reviews for ABCA3 Protein (NBP1-89310PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA3 Protein (NBP1-89310PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCA3 Products

Research Areas for ABCA3 Protein (NBP1-89310PEP)

Find related products by research area.

Blogs on ABCA3

There are no specific blogs for ABCA3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Formalin-fixed paraffin-embedded tissue sections of human prostate cancer were probed for ABCA1 mRNA (ACD RNAScope Probe, catalog # 432291; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus Biologicals catalog # NB400-105) at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
ABCA1 Antibody - BSA Free
NB400-105
Immunohistochemistry: DC-LAMP Antibody (1010E1.01) [DDX0191P-100] - Analysis of human lymph node paraffin section with clone 1010E1 (DX0191)
DC-LAMP Antibody (1010E1.01)
DDX0191P-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCA3