Novus Biologicals products are now on bio-techne.com

14-3-3 sigma/Stratifin Recombinant Protein Antigen

Images

 
There are currently no images for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

14-3-3 sigma/Stratifin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REXO2.

Source: E. coli

Amino Acid Sequence: LSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SFN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 14-3-3 sigma/Stratifin Recombinant Protein Antigen

  • 14-3-3 protein sigma
  • 1433 sigma
  • 14-3-3 sigma
  • Epithelial cell marker protein 1
  • HME1
  • SFN
  • stratifin
  • YWHAS

Background

14-3-3 sigma was identified as an epithelial cell marker. It is part of the 14-3-3 family of proteins in which seven isoforms have been identified: beta, zeta, gamma, eta, epsilon, tau, and sigma. 14-3-3 proteins function as adaptors that bind with a number of partners to mediate various signaling pathways. 14-3-3 sigma is also called stratifin or HME1 and appears to function as a tumor suppressor whose expression can be downregulated via methylation. Loss of 14-3-3 sigma expression results in a defective G2/M phase checkpoint and appears to contribute to both epithelial and non-epithelial tumorigenesis. Alternate names for 14-3-3 sigma include epithelial marker protein 1, SFN and YWHAS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP1-80610PEP
Species: Hu
Applications: AC

Publications for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP) (0)

There are no publications for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP) (0)

There are no reviews for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 14-3-3 sigma/Stratifin Products

Research Areas for 14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP)

Find related products by research area.

Blogs on 14-3-3 sigma/Stratifin

There are no specific blogs for 14-3-3 sigma/Stratifin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 14-3-3 sigma/Stratifin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SFN