![Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in transfected 293T cell line by ALPPL2 monoclonal antibody (M07), clone 2B3. Lane 1: ALPPL2 transfected lysatE (57.5 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ALPPL2-Antibody-2B3-Western-Blot-H00000251-M07-img0009.jpg "Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in transfected 293T cell line by ALPPL2 monoclonal antibody (M07), clone 2B3. Lane 1: ALPPL2 transfected lysatE (57.5 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC, IP, ELISA, KD |
| Clone | 2B3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE |
| Specificity | ALPPL2 - alkaline phosphatase, placental-like 2 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ALPG |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ALPPL2 Antibody (H00000251-M07)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/ALPPL2-Antibody-2B3-Immunohistochemistry-Paraffin-H00000251-M07-img0006.jpg "Immunohistochemistry-Paraffin: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml")
![Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - ALPPL2 over-expressed 293 cell line. Lane 2 cotransfected with ALPPL2 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000251-M07. GAPDH (36.1 kDa) used as loading control.](http://images.novusbio.com/fullsize/ALPPL2-Antibody-2B3-Western-Blot-H00000251-M07-img0004.jpg "Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - ALPPL2 over-expressed 293 cell line. Lane 2 cotransfected with ALPPL2 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000251-M07. GAPDH (36.1 kDa) used as loading control.")
![Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in A-431 (Cat # L015V1).](http://images.novusbio.com/fullsize/ALPPL2-Antibody-2B3-Western-Blot-H00000251-M07-img0008.jpg "Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in A-431 (Cat # L015V1).")
![Immunoprecipitation: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 transfected lysate using anti-ALPPL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ALPPL2 rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/ALPPL2-Antibody-2B3-Immunoprecipitation-H00000251-M07-img0007.jpg "Immunoprecipitation: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 transfected lysate using anti-ALPPL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ALPPL2 rabbit polyclonal antibody.")
![Sandwich ELISA Capture: ALPPL2 Antibody (2B3) [H00000251-M07] - Detection limit for recombinant GST tagged ALPPL2 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ALPPL2-Antibody-2B3-Sandwich-ELISA-Capture-H00000251-M07-img0010.jpg "Sandwich ELISA Capture: ALPPL2 Antibody (2B3) [H00000251-M07] - Detection limit for recombinant GST tagged ALPPL2 is 0.1 ng/ml as a capture antibody.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
