Home » SLC17A1/NPT » SLC17A1/NPT Proteins » SLC17A1/NPT Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC17A1/NPT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC17A1/NPT Recombinant Protein Antigen (NBP2-55004PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC17A1/NPT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC17A1/NPT.

Source: E. coli

Amino Acid Sequence: CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC17A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55004.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC17A1/NPT Recombinant Protein Antigen

  • sodium-dependent phosphate transport protein 1
  • Na/Pi-4
  • NAPI-1
  • NPT1
  • NPT-1
  • SLC17A1
  • solute carrier family 17 (sodium phosphate), member 1

Background

Neomycin phosphotransferase II (nptII) gene is used in selection of transformed organisms. It was initially isolated from the transposon Tn5 that was present in the bacterium strain Escherichia coli K12. The gene codes for the aminoglycoside 3'-phosphotransferase (denoted aph(3')-II or NPTII) enzyme. NPTII is probably the most widely used selectable marker for plant transformation. It is also used in gene expression and regulation studies in different organisms in part because N-terminal fusions can be constructed that retain enzymatic activity. In animal cells, G418 and neomycin are used as selectable agents.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC34A1 Antibody
(10B1.3E9) - BSA Free
NBP2-42216
Flow Cytometry SLC34A1 Antibody (10B1.3E9) - BSA Free
Flow Cytometry SLC34A1 Antibody (10B1.3E9) - BSA Free
Flow Cytometry SLC34A1 Antibody (10B1.3E9) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SLC20A1 Antibody
NBP1-32252
Western Blot SLC20A1 Antibody
Immunohistochemistry-Paraffin SLC20A1 Antibody
Immunohistochemistry-Paraffin SLC20A1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Sir2.1 Antibody
NB100-1923
Western Blot Sir2.1 Antibody
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
GLUT9 Antibody -
BSA Free
NBP1-05054
Immunohistochemistry GLUT9 Antibody - BSA Free
Immunohistochemistry GLUT9 Antibody - BSA Free
Immunohistochemistry GLUT9 Antibody - BSA Free
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SLC22A12 Antibody
(2B5)
H00116085-M02
Western Blot SLC22A12 Antibody (2B5)
ELISA SLC22A12 Antibody (2B5)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
SLC17A2 Antibody
NBP1-60072
Western Blot SLC17A2 Antibody
Immunohistochemistry-Paraffin SLC17A2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Immunoprecipitation HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
SLC17A3 Antibody -
Azide and BSA Free
NBP3-25684
Western Blot SLC17A3 Antibody - Azide and BSA Free
Western Blot SLC17A3 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SLC17A3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SLC20A2 Antibody
(4B1)
H00006575-M04
ELISA SLC20A2 Antibody (4B1)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/ Immunofluorescence TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
NAPRT1 Antibody
(0C6)
NBP3-43003
NAPRT1 Antibody (0C6)
Species: Hu, Mu
Applications: ELISA, IHC, WB
FGF-23 Antibody
(283507) [Unconjugate
MAB26291
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]
Western Blot FGF-23 Antibody (283507) [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC
SLC16A9 Antibody
NBP2-31030
Immunocytochemistry/ Immunofluorescence SLC16A9 Antibody
Immunohistochemistry-Paraffin SLC16A9 Antibody
Immunohistochemistry-Paraffin SLC16A9 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLC25A33 Antibody
NBP1-32499
Western Blot SLC25A33 Antibody
Immunohistochemistry-Paraffin SLC25A33 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLC17A1/NPT
Recombinant Protein A
NBP2-55004PEP
SLC17A1/NPT Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SLC17A1/NPT Recombinant Protein Antigen (NBP2-55004PEP) (0)

There are no publications for SLC17A1/NPT Recombinant Protein Antigen (NBP2-55004PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A1/NPT Recombinant Protein Antigen (NBP2-55004PEP) (0)

There are no reviews for SLC17A1/NPT Recombinant Protein Antigen (NBP2-55004PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC17A1/NPT Recombinant Protein Antigen (NBP2-55004PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC17A1/NPT Products

Blogs on SLC17A1/NPT

There are no specific blogs for SLC17A1/NPT, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC17A1/NPT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC17A1