![Sandwich ELISA: YF5 Antibody (1E4) [H00000755-M05] - Detection limit for recombinant GST tagged C21orf2 is 3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/YF5-Antibody-1E4-Sandwich-ELISA-H00000755-M05-img0001.jpg "Sandwich ELISA: YF5 Antibody (1E4) [H00000755-M05] - Detection limit for recombinant GST tagged C21orf2 is 3 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA |
| Clone | 1E4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | C21orf2 (NP_004919, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCG |
| Specificity | C21orf2 - chromosome 21 open reading frame 2 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | C21ORF2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against recombinant protein on ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Western_Blot_17043.jpg)
![Simple Western CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Immunohistochemistry_17641.jpg)
