Could you tell me if this ab can be used for IHC?

Name: WDR79 Antibody (1F12)
Brand: Novus Biologicals
SKU: H00055135-M04
Price: 519 USD

Question

Accepted Answer

Product H00055135-M04 has not yet been tested in IHC. The antibody is validated for WB, ELISA, ICC/IF, IP, and S-ELISA, so there is a good chance it might also work in IHC. If you do decide to try this antibody in your experiment, you can utilize our Innovator's Reward Program. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply purchase the product as normal and submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice. Reviews may also be submitted by emailing innovators@novusbio.com.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, RtSpecies Glossary
Applications	WB, ELISA, ICC/IF, IP
Clone	1F12
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Immunogen	WDR79 (NP_060551.1, 62 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
Specificity	WDR79 - WD repeat domain 79 (1F12)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	WRAP53
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Publications using H00055135-M04	Applications	Species
Mata-Garrido J, Tapia O, Casafont I et al. Persistent accumulation of unrepaired DNA damage in rat cortical neurons: nuclear organization and ChIP-seq analysis of damaged DNA. Acta Neuropathol Commun 2018-07-26 [PMID: 30049290]
Pederiva C, Bohm S, Julner A, Farnebo M. Splicing controls the ubiquitin response during DNA double-strand break repair. Cell Death Differ 2016-06-17 [PMID: 27315300]
Rassoolzadeh H, Bohm S, Hedstrom E et al. Overexpression of the scaffold WD40 protein WRAP53beta enhances the repair of and cell survival from DNA double-strand breaks. Cell Death Dis 2016-06-16 [PMID: 27310875]
Mata-Garrido J, Casafont I, Tapia O et al. Neuronal accumulation of unrepaired DNA in a novel specific chromatin domain: structural, molecular and transcriptional characterization. Acta Neuropathol Commun 2016-04-22 [PMID: 27102221]
Hedstrom E, Pederiva C, Farnebo J et al. Downregulation of the cancer susceptibility protein WRAP53beta in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome. Cell Death Dis 2015-01-01 [PMID: 26426684] (ICC/IF)	ICC/IF
Henriksson Sofia, Rassoolzadeh Hanif, Hedstrom Elisabeth et al. The scaffold protein WRAP53beta orchestrates the ubiquitin response critical for DNA double-strand break repair. Genes Dev. 2014-12-15 [PMID: 25512560] (IP, Human)	IP	Human

WDR79 Antibody (1F12)

Species Glossary

Images

Product Details

Order Details

WDR79 Antibody (1F12) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for WDR79 Antibody (1F12)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for WDR79 Antibody (H00055135-M04)(6)

Reviews for WDR79 Antibody (H00055135-M04) (0)

Product General Protocols

Video Protocols

FAQs for WDR79 Antibody (H00055135-M04). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional WDR79 Products

Research Areas for WDR79 Antibody (H00055135-M04)

Blogs on WDR79

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	WRAP53
Entrez	55135(Human)
Uniprot	NP_060551(Human)