![Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human cerebral cortex, kidney, liver and testis using Anti-DCAF7 antibody NBP1-92589 (A) shows similar protein distribution across tissues to independent antibody NBP1-92590 (B).](http://images.novusbio.com/fullsize/WDR68-Antibody-Immunohistochemistry-Paraffin-NBP1-92589-img0008.jpg "Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human cerebral cortex, kidney, liver and testis using Anti-DCAF7 antibody NBP1-92589 (A) shows similar protein distribution across tissues to independent antibody NBP1-92590 (B).")
| Reactivity | Hu, Dr, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCAF7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92589 | Applications | Species |
|---|---|---|
| Degoutin JL, Milton CC, Yu E et al. Riquiqui and Minibrain are regulators of the Hippo pathway downstream of Dachsous. Nat Cell Biol. 2013-08-18 [PMID: 23955303] (ICC/IF, IF/IHC, Drosophila) | ICC/IF, IF/IHC | Drosophila |
Secondary Antibodies |
Isotype Controls |
Research Areas for WDR68 Antibody (NBP1-92589)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: WDR68 Antibody [NBP1-92589] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize/WDR68-Antibody-Western-Blot-NBP1-92589-img0007.jpg "Western Blot: WDR68 Antibody [NBP1-92589] - Analysis in human cell line SH-SY5Y.")
![Immunocytochemistry/Immunofluorescence: WDR68 Antibody [NBP1-92589] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.](http://images.novusbio.com/fullsize/WDR68-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92589-img0004.jpg "Immunocytochemistry/Immunofluorescence: WDR68 Antibody [NBP1-92589] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.")
![Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human testis.](http://images.novusbio.com/fullsize/WDR68-Antibody-Immunohistochemistry-Paraffin-NBP1-92589-img0011.jpg "Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human testis.")
![Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human liver.](http://images.novusbio.com/fullsize/WDR68-Antibody-Immunohistochemistry-Paraffin-NBP1-92589-img0009.jpg "Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human liver.")
![Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/WDR68-Antibody-Western-Blot-NBP1-92589-img0010.jpg "Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human kidney.](http://images.novusbio.com/fullsize/WDR68-Antibody-Immunohistochemistry-Paraffin-NBP1-92589-img0012.jpg "Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92589] - Staining of human kidney.")
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Western Blot DYRK2 Antibody (599542) [Unconjugated]](https://images.novusbio.com/images2/DYRK2_MAB5408_Western_Blot_9913.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")