Home » VPS16 » VPS16 Antibodies » VPS16 Antibody (2F10)
Novus Biologicals products are now on bio-techne.com

VPS16 Antibody (2F10)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05] - Immunofluorescence of monoclonal antibody to VPS16 on HeLa cell. [antibody concentration 40 ug/ml]
Immunocytochemistry/ Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05] - Immunofluorescence of monoclonal antibody to VPS16 on HeLa cell. [antibody concentration 40 ug/ml]
Immunocytochemistry/ Immunofluorescence: VPS16 Antibody (2F10) [H00064601-M05] - Analysis of monoclonal antibody to VPS16 on HeLa cell. Antibody concentration 40 ug/ml
Sandwich ELISA: VPS16 Antibody (2F10) [H00064601-M05] - Detection limit for recombinant GST tagged VPS16 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

VPS16 Antibody (2F10) Summary

Immunogen
VPS16 (NP_072097.2, 754 a.a. ~ 839 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK
Specificity
VPS16 - vacuolar protein sorting 16 homolog (S. cerevisiae) (2F10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VPS16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VPS16 Antibody (2F10)

  • hVPS16
  • vacuolar protein sorting 16 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 16
  • vacuolar protein sorting-associated protein 16 homolog

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

VPS18 Antibody
NBP1-82906
Western Blot VPS18 Antibody
Immunohistochemistry-Paraffin VPS18 Antibody
Immunohistochemistry-Paraffin VPS18 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
VPS11 Antibody
(8L3D8)
NBP3-15923
Immunohistochemistry-Paraffin VPS11 Antibody (8L3D8)
Immunohistochemistry-Paraffin VPS11 Antibody (8L3D8)
Western Blot VPS11 Antibody (8L3D8)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TMUB1 Antibody
NBP1-86731
Western Blot TMUB1 Antibody
Immunocytochemistry/ Immunofluorescence TMUB1 Antibody
Immunohistochemistry-Paraffin TMUB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VPS41 Antibody
NB100-2425
Immunohistochemistry-Paraffin VPS41 Antibody
Immunohistochemistry-Paraffin VPS41 Antibody
Immunohistochemistry-Paraffin VPS41 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Alkaline
Phosphatase/ALPL Anti ...
AF2910
Immunohistochemistry Alkaline Phosphatase/ALPL Antibody [Unconjugated]
Western Blot Alkaline Phosphatase/ALPL Antibody [Unconjugated]
Flow Cytometry Alkaline Phosphatase/ALPL Antibody [Unconjugated]
(44 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Rab7a Antibody
NBP1-87174
Immunocytochemistry/ Immunofluorescence Rab7a Antibody
Western Blot Rab7a Antibody
Immunohistochemistry-Paraffin Rab7a Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
VPS39 Antibody -
BSA Free
NBP1-76535
Immunocytochemistry/ Immunofluorescence VPS39 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence VPS39 Antibody - BSA Free
Immunohistochemistry-Paraffin VPS39 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RAB7B Antibody
(3B3)
H00338382-M01
Western Blot RAB7B Antibody (3B3)
ELISA RAB7B Antibody (3B3)
Immunoprecipitation RAB7B Antibody (3B3)
(2 Reviews)
(7 Publications)
Species: Hu
Applications: ELISA, IP, WB
SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Rab5a Antibody
NB120-13253
Western Blot Rab5a Antibody
Immunohistochemistry Rab5a Antibody
Immunohistochemistry-Paraffin Rab5a Antibody
(2 Reviews)
(17 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
VTI1B Antibody
NBP2-33414
Western Blot VTI1B Antibody
Immunohistochemistry-Paraffin VTI1B Antibody
Immunocytochemistry/ Immunofluorescence VTI1B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VPS8 Antibody (2C8)
H00023355-M01
Sandwich ELISA VPS8 Antibody (2C8)
Immunocytochemistry/ Immunofluorescence VPS8 Antibody (2C8)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NSF Antibody
NBP1-87035
Immunocytochemistry/ Immunofluorescence NSF Antibody
Immunohistochemistry-Paraffin NSF Antibody
Western Blot NSF Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RAB6A Antibody
NBP1-33110
Immunocytochemistry/ Immunofluorescence RAB6A Antibody
Knockout Validated RAB6A Antibody
Western Blot RAB6A Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
VPS45 Antibody -
Azide and BSA Free
NB100-98931
Immunohistochemistry-Paraffin VPS45 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin VPS45 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin VPS45 Antibody - Azide and BSA Free
Species: Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
VPS33B Antibody
NBP2-20874
Immunohistochemistry-Paraffin VPS33B Antibody
Western Blot VPS33B Antibody
Western Blot VPS33B Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Publications for VPS16 Antibody (H00064601-M05) (0)

There are no publications for VPS16 Antibody (H00064601-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS16 Antibody (H00064601-M05) (0)

There are no reviews for VPS16 Antibody (H00064601-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS16 Antibody (H00064601-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS16 Products

Array H00064601-M05

Blogs on VPS16.

Check out the latest blog posts on VPS16.
UVRAG - A regulator of membrane trafficking in autophagy and endocytosis
UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto...  Read full blog post.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS16 Antibody (2F10) and receive a gift card or discount.


Bioinformatics

Gene Symbol VPS16
Entrez
Uniprot