| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UVRAG. Source: E. coli Amino Acid Sequence: QLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | UVRAG |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86861.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
| Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Research Areas for UVRAG Recombinant Protein Antigen (NBP1-86861PEP)Find related products by research area.
|
|
UVRAG - A regulator of membrane trafficking in autophagy and endocytosis UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto... Read full blog post. |
|
TFEB - An essential regulator of lysosome biogenesis Transcription factor EB (TFEB) is a member of the MiTF/TFE (Microphthalmia/TFE) subfamily of basic/helix-loop-helix/leucine zipper transcription factors. This group of proteins is involved in the proliferation and development of specific cell type... Read full blog post. |
|
Beclin 2, a mammal-specific homolog of Beclin 1 with unique functional similarities and differences Beclin 2 (BECN2) is also called Beclin-1-like protein 1/ BECN1P1 and it was recently identified by He et al 2013 as a mammal-specific homolog of the evolutionarily conserved protein Beclin 1 which is well established for its role in the regulation ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UVRAG |
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
