UMODL1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
UMODL1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for UMODL1 Antibody
Background
UMODL1 is a gene that codes for a protein expressed in the testis and fetal thymus that has four isoforms, with lengths of 1318, 1446, 1246, and 1374 amino acids and weights of approximately 144, 157, 137, and 149 kDa respectively. Current research is being done on diseases and disorders related to this gene including Kallmann syndrome, Down syndrome, myopia, hepatitis, prostatitis, and nueronitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: EnzAct
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: Bind
Species: Rt
Applications: BA, BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Publications for UMODL1 Antibody (NBP2-38102) (0)
There are no publications for UMODL1 Antibody (NBP2-38102).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UMODL1 Antibody (NBP2-38102) (0)
There are no reviews for UMODL1 Antibody (NBP2-38102).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for UMODL1 Antibody (NBP2-38102) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UMODL1 Products
Blogs on UMODL1